KEGG   Felis catus (domestic cat): 100502578Help
Entry
100502578         CDS       T02385                                 

Gene name
BID
Definition
(RefSeq) BH3-interacting domain death agonist
  KO
K04726  BH3 interacting domain death agonist
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04071  Sphingolipid signaling pathway
fca04115  p53 signaling pathway
fca04210  Apoptosis
fca04215  Apoptosis - multiple species
fca04217  Necroptosis
fca04650  Natural killer cell mediated cytotoxicity
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04071 Sphingolipid signaling pathway
    100502578 (BID)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    100502578 (BID)
   04215 Apoptosis - multiple species
    100502578 (BID)
   04217 Necroptosis
    100502578 (BID)
   04115 p53 signaling pathway
    100502578 (BID)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    100502578 (BID)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100502578 (BID)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    100502578 (BID)
   05014 Amyotrophic lateral sclerosis (ALS)
    100502578 (BID)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    100502578 (BID)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    100502578 (BID)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    100502578 (BID)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    100502578 (BID)
   05162 Measles
    100502578 (BID)
   05164 Influenza A
    100502578 (BID)
   05161 Hepatitis B
    100502578 (BID)
   05160 Hepatitis C
    100502578 (BID)
   05168 Herpes simplex virus 1 infection
    100502578 (BID)
   05163 Human cytomegalovirus infection
    100502578 (BID)
   05167 Kaposi sarcoma-associated herpesvirus infection
    100502578 (BID)
   05169 Epstein-Barr virus infection
    100502578 (BID)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    100502578 (BID)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BID Bcl-2 CRM1_C DUF5631 bcl-2I13 DUF1002
Motif
Other DBs
NCBI-GeneID: 100502578
NCBI-ProteinID: XP_003988343
Ensembl: ENSFCAG00000011109
Position
B4
AA seq 196 aa AA seqDB search
MDSQVSNGSSLQDEHITNLLVFGFLQNCSNYNFHKELEVLGRELPVPPAYLQEDHDDGLQ
TDGNRCSRFLDSEETDSESQEEIIQDIARQLAQIGDRMDHSIHPRVVNNLAMQFMNVNLS
EEDRRKHLAAALEQVLQTYPKDMEREKTVLMLAMVLAKKVADHTPSLLRDVFRTTVNFIN
QNLLTYVRNLVRNEMD
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggattctcaggtcagcaatggttcaagcctccaggatgagcacatcacaaacttgctg
gtgtttggcttcctccaaaactgctccaactataatttccataaagagttagaggtgttg
ggccgtgaactgcctgtgccaccagcttacctgcaggaggaccacgatgatgggctccag
acagatggcaaccggtgcagccgcttcttggatagcgaggagacagattctgagagtcaa
gaggaaatcatccaagatatcgccaggcagctcgcccaaatcggggataggatggatcac
agcatccacccaagagtggtgaataacctggcaatgcagtttatgaatgtgaacctgtca
gaagaagacagaaggaagcaccttgctgctgcactggagcaggtcctacagacttacccg
aaggacatggagagggagaagaccgtgctcatgttggccatggtattggccaaaaaggtg
gccgatcacacaccgtccttgctccgtgatgtctttcgcacaacagtgaactttattaac
cagaacctactcacatatgtgaggaacttagtcagaaatgagatggactga

DBGET integrated database retrieval system