KEGG   Felis catus (domestic cat): 100510799Help
Entry
100510799         CDS       T02385                                 

Gene name
EGFR
Definition
(RefSeq) epidermal growth factor receptor isoform X1
  KO
K04361  epidermal growth factor receptor [EC:2.7.10.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04151  PI3K-Akt signaling pathway
fca04510  Focal adhesion
fca04520  Adherens junction
fca04540  Gap junction
fca04630  Jak-STAT signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca05160  Hepatitis C
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    100510799 (EGFR)
   04015 Rap1 signaling pathway
    100510799 (EGFR)
   04010 MAPK signaling pathway
    100510799 (EGFR)
   04012 ErbB signaling pathway
    100510799 (EGFR)
   04630 Jak-STAT signaling pathway
    100510799 (EGFR)
   04066 HIF-1 signaling pathway
    100510799 (EGFR)
   04068 FoxO signaling pathway
    100510799 (EGFR)
   04020 Calcium signaling pathway
    100510799 (EGFR)
   04072 Phospholipase D signaling pathway
    100510799 (EGFR)
   04151 PI3K-Akt signaling pathway
    100510799 (EGFR)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    100510799 (EGFR)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    100510799 (EGFR)
   04520 Adherens junction
    100510799 (EGFR)
   04540 Gap junction
    100510799 (EGFR)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    100510799 (EGFR)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    100510799 (EGFR)
   04915 Estrogen signaling pathway
    100510799 (EGFR)
   04921 Oxytocin signaling pathway
    100510799 (EGFR)
   04926 Relaxin signaling pathway
    100510799 (EGFR)
   04928 Parathyroid hormone synthesis, secretion and action
    100510799 (EGFR)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    100510799 (EGFR)
   05206 MicroRNAs in cancer
    100510799 (EGFR)
   05205 Proteoglycans in cancer
    100510799 (EGFR)
   05230 Central carbon metabolism in cancer
    100510799 (EGFR)
   05231 Choline metabolism in cancer
    100510799 (EGFR)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    100510799 (EGFR)
  09162 Cancer: specific types
   05210 Colorectal cancer
    100510799 (EGFR)
   05212 Pancreatic cancer
    100510799 (EGFR)
   05225 Hepatocellular carcinoma
    100510799 (EGFR)
   05226 Gastric cancer
    100510799 (EGFR)
   05214 Glioma
    100510799 (EGFR)
   05218 Melanoma
    100510799 (EGFR)
   05219 Bladder cancer
    100510799 (EGFR)
   05215 Prostate cancer
    100510799 (EGFR)
   05213 Endometrial cancer
    100510799 (EGFR)
   05224 Breast cancer
    100510799 (EGFR)
   05223 Non-small cell lung cancer
    100510799 (EGFR)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    100510799 (EGFR)
  09172 Infectious disease: viral
   05160 Hepatitis C
    100510799 (EGFR)
   05163 Human cytomegalovirus infection
    100510799 (EGFR)
   05165 Human papillomavirus infection
    100510799 (EGFR)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    100510799 (EGFR)
   01522 Endocrine resistance
    100510799 (EGFR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    100510799 (EGFR)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    100510799 (EGFR)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     100510799 (EGFR)
Protein kinases [BR:fca01001]
 Receptor tyrosine kinases (RTK)
  EGFR family [OT]
   100510799 (EGFR)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   100510799 (EGFR)
  Exosomal proteins of pancreatic cancer cells
   100510799 (EGFR)
  Exosomal proteins of bladder cancer cells
   100510799 (EGFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Recep_L_domain GF_recep_IV Pkinase Furin-like APH Kinase-like Haspin_kinase Kdo Borrelia_P83
Motif
Other DBs
NCBI-GeneID: 100510799
NCBI-ProteinID: XP_006929148
Ensembl: ENSFCAG00000015468
Position
A2
AA seq 1207 aa AA seqDB search
MRPSGTAGAALLLLLAAHFQASPALEEKKVCQGTSNRLTQLGTFEDHFLSLQRMFNNCEV
VLGNLEITYMQRNYDLSFLKTIQEVAGYVLIALNTVEKIPLENLQIIRGNVLYENTHALS
VLSNYGTNKTGLRELPMRNLHEILQGAVRFSNNPVLCNVETIQWRDIVDNDFISNMSMDF
QNHVGNCQKCDPGCPNGSCWGPGKENCQKLTKIICAQQCSGRCRGRSPSDCCHNQCAAGC
TGPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYV
VTDHGSCVRACSSDSYEVEEDGVRKCKKCEGPCRKVCNGIGIGEFKDTLSINATNIKHFK
NCTSISGDLHILPVAFRGDSFTHTPPLDPKELDILKTVKEITGFLLIQAWPENRTDLHAF
ENLEIIRGRTKQHGQFSLAVVGLDITSLGLRSLKEISDGDVIVSGNQKLCYANTINWKKL
FGTSSQKTKIINNKDEKGCKAIGHVCHPLCSSEGCWGPEPKDCVSCQNVTRGKECVEKCN
VLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDSCVQCAHYIDGPHCVKTCPAGIM
GENNTLVWKFADANRMCHLCHSNCTYGCSGPGLEGCATDGPKIPSIATGIVGGLLLVVVV
ALGVGLFLRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS
GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI
CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA
RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY
GVTVWELMTFGSKPYDGIPASEISTILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK
FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMEDVVDADEYLIPQ
QGFFHSPSTSRTPLLSSLSATSNNSTVTCIDRNGSCPLKEDSFLQRYSSDPTGTLTEDNM
DDTFLPAPEYINQAVPKRPAGSVQNPVYHNQPLNPAPGRDPHYQNPHSNAVDNPEYLNTH
PTCVNSVLDGPTLWAQKGNHQISLDNPDYQQDFFPKEAKSNGIFKGPAAENADYLRVAPP
SSEFIGA
NT seq 3624 nt NT seq  +upstreamnt  +downstreamnt
atgcgaccctccgggaccgcgggagccgcgctcctgctgctgctggctgcgcacttccag
gcgagtccggcgctggaggagaagaaagtttgccaaggcacaagtaaccggctcacccag
ttgggcacttttgaggaccactttctcagcctgcagaggatgtttaataactgtgaggtg
gtccttgggaatttggaaatcacctacatgcaaaggaattatgacctttccttcttaaaa
accatccaagaggttgccggctatgtactcattgccctcaacacagtggagaagattccc
ttggaaaacctgcagatcatccgaggaaatgtgctctatgaaaacacccatgccttatct
gtcttatccaactatggcacaaataaaaccggactgcgggagctgcccatgagaaactta
catgaaatcctgcaaggcgctgtgcggttcagcaacaaccctgtcctctgcaacgtggaa
accatccagtggcgggatatcgttgacaatgatttcataagcaacatgtcgatggacttc
cagaaccacgtgggcaactgccaaaagtgtgatccaggatgtcccaatggaagctgctgg
ggtccgggaaaggagaattgccagaaattgaccaaaatcatctgcgcccagcagtgttcc
gggcgctgccgcggcaggtcccccagcgactgctgccataaccagtgtgctgccggctgc
acggggccccgagagagcgactgcctggtctgccgcaagttccgggatgaagccacgtgc
aaggacacctgcccgccactcatgctctacaaccccaccacctaccagatggacgtcaac
ccagagggaaaatacagctttggtgccacctgtgtgaagaaatgcccccgtaactacgtg
gtgacagaccacggttcgtgtgtccgtgcctgcagttctgacagctacgaagtggaggaa
gatggcgtccgcaagtgtaaaaagtgtgaggggccttgccgtaaagtttgtaatggaata
ggaattggtgaatttaaagacacactttccatcaatgctacaaatattaaacacttcaaa
aattgcacctcgatcagtggagatcttcatatcctgccagtagcatttagaggtgactcc
ttcacgcatactccacctctagatccaaaggaactggatattctaaaaactgtaaaggaa
attacagggtttttgctgattcaggcctggcctgaaaacaggactgacctccatgctttc
gagaacctagaaatcatacgtggaagaacaaagcaacatggtcagttttctcttgcggtt
gtgggcctggacataacgtccttgggattacgctccctcaaggagataagtgatggagat
gtgatcgtttcaggaaaccaaaaattgtgctatgcaaatacaataaactggaaaaaactg
tttgggacttcaagtcagaaaaccaaaattataaacaacaaagatgaaaaaggctgcaag
gccataggccatgtctgtcatccgttatgctcatcagagggatgctggggcccggagccg
aaagactgcgtgtcctgccaaaacgtcacccgtggcaaggaatgtgtggagaagtgcaat
gttctggagggggagccaagggagtttgtggagaattctgagtgcatacagtgccatcca
gaatgcctgccccaggccatgaatatcacctgcacaggacgaggaccagacagctgcgtg
cagtgtgcacactacatcgacggccctcactgcgtcaagacctgcccggctggcatcatg
ggagaaaacaacaccctggtctggaagtttgcggacgccaatcgcatgtgtcacctgtgc
cattcaaactgtacctacggctgttctgggccaggtcttgaaggctgtgctacagatggg
cccaagatcccatccatcgccactgggattgttgggggcctcctcttggtggtggtggtg
gcccttggggtgggcctctttctgcgccgacgccacatcgtccgcaagcgcacacttcgc
agactgctgcaggaaagagagcttgttgagcctcttacgcccagcggagaagctcccaac
caagctctcttgaggatcttaaaggaaacagaattcaaaaagatcaaggtgctgggctct
ggagcatttggcacagtgtacaagggactctggatcccagaaggtgagaaggttaaaatt
cctgtggccatcaaggagttacgagaagccacatctccaaaagccaacaaggaaatcctt
gatgaagcttacgtgatggccagtgtggacaatccccacgtgtgccgcctcctgggcatc
tgcctgacgtccacggtccagctcatcacacagctcatgcccttcggctgcctcctggac
tatgtccgcgagcacaaggacaacattggctcccagtacctgctcaactggtgtgtgcag
attgcgaagggcatgaactacctggaagaccggcgcttggtgcaccgtgacctggcagcc
aggaatgtcctggtgaagacgccacagcatgtcaagatcacagattttgggctggccaaa
ctgcttggtgccgaggagaaagaataccacgcggaaggaggcaaagtgcctatcaagtgg
atggctttggaatcaattttacaccgaatttacacccaccaaagtgacgtctggagctat
ggagtcaccgtttgggagttgatgacctttgggtctaaaccttacgacggaatccccgca
agtgagatctcgaccatcctggagaaaggagagcgcctcccgcagccacccatatgcacc
atcgatgtctacatgatcatggtcaagtgctggatgatagatgcagacagtcgcccgaaa
ttccgtgagttgatcattgaattctccaaaatggcccgagacccccagcgctaccttgtc
atccagggagatgagagaatgcatctgccaagccctacagactccaatttttaccgcgcc
ctgatggacgaagaagacatggaagacgtcgtagatgccgatgagtacctcatcccccag
caaggcttcttccacagcccctccacatcccggacccccctcctgagttctctgagtgcc
accagcaacaattccaccgtgacttgcatcgatagaaatgggagctgccccctcaaggaa
gacagcttcttgcagcggtacagctcagaccccactggcaccttgactgaggacaacatg
gatgacactttcctcccggcacctgaatacataaaccaggctgttcccaaaaggcctgcg
ggttccgtccagaaccccgtctatcacaatcagcctctaaatccagctcctggcagagac
cctcactaccaaaatccccacagcaatgcagtggacaaccctgagtatctcaacacccac
cccacttgcgtcaacagtgtgctcgacggccccaccctctgggcccagaaaggcaaccac
cagattagcctggacaaccctgactaccagcaggacttctttcccaaggaagccaagtca
aatggcatctttaagggtcctgcagctgaaaatgcagactacctaagggtagcaccgccc
agcagtgaatttattggagcatga

DBGET integrated database retrieval system