KEGG   Felis catus (domestic cat): 100533976Help
Entry
100533976         CDS       T02385                                 

Gene name
PDE5A
Definition
(RefSeq) cGMP-specific 3',5'-cyclic phosphodiesterase
  KO
K13762  cGMP-specific 3',5'-cyclic phosphodiesterase [EC:3.1.4.35]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca01100  Metabolic pathways
fca04022  cGMP-PKG signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    100533976 (PDE5A)
 09130 Environmental Information Processing
  09132 Signal transduction
   04022 cGMP-PKG signaling pathway
    100533976 (PDE5A)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.35  3',5'-cyclic-GMP phosphodiesterase
     100533976 (PDE5A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PDEase_I GAF GAF_2 UTP15_C HD
Motif
Other DBs
NCBI-GeneID: 100533976
NCBI-ProteinID: NP_001191705
Ensembl: ENSFCAG00000010364
UniProt: F1CNG6
Position
B1
AA seq 823 aa AA seqDB search
MVNAWFAERVHTIPVCKEGIRSHTESCSCPSQQSPRADSSAPGTPTRKISASEFDRPLRP
IVVKDSEGTVSFLSDSEKKEQMPLTPPRFDNDEGDQCSRLLELVKDISSHLDVTALCHKI
FLHIHGLISADRYSLFLVCEDSSNDKFLISRLFDVAEGSTLEEASNNCIRLEWNKGIVGH
VAAFGEPLNIKDAYEDPRFNAEVDQITGYRTQSILCMPIKNHREEVVGVAQAINKRSGNG
GTFTEKDEKDFAAYLAFCGIVLHNAQLYETSLLENKRNQVLLDLASLIFEEQQSLEVILK
KIAATIISFMQVQKCTIFIVDEDCSDSFSSVFHMECEELEKSSDTLTRERDANRINYMYA
QYVKNTMEPLNIPDVSKDKRFPWTNENTGSVSQQFIRSLLCTPIKNGKKNKVIGVCQLVN
KMEENTGKVKPFNRNDEQFLEAFVIFCGLGIQNTQMYEAVERAMAKQMVTLEVLSYHASA
AEEETRELQSLAAAVVPSAQTLKITDFSFSDFELSDLETALCTIRMFTDLNLVQNFQMKH
EVLCRWILSVKKNYRKNVAYHNWRHAFNTAQCMFAALKAGKIQNKLTDLETLALLIAALS
HDLDHRGVNNSYIQRSEHPLAQLYCHSIMEHHHFDQCLMILNSPGNQILSGLSIEEYKTT
LKIIKQAILATDLALYIKRRGEFFELIRKNQFNLEDPHQKELFLAMLMTACDLSAITKPW
PIQQRIAELVATEFFDQGDRERKELNIEPADLMNREKKNKIPSMQVGFIDAICLQLYEAL
THVSEDCFPLLDGCRKNRQKWQALAEQQEKMLINGESSQAKRN
NT seq 2472 nt NT seq  +upstreamnt  +downstreamnt
atggtcaatgcctggtttgctgagagagtccacaccatccctgtgtgcaaagaaggtatc
agaagccacacagaatcttgctcttgcccctcacagcagagtccccgtgcagatagcagt
gcacctggaacaccaaccaggaaaatctctgcctccgaatttgaccggcctcttagaccc
attgttgtcaaggattctgagggaaccgtgagcttcctctctgactcagaaaagaaggaa
cagatgcctctaacccccccaaggtttgataatgatgaaggggaccagtgctcaagactc
ttggaattagtgaaagatatctctagtcatttggatgtcacagccttatgtcacaaaatt
ttcttgcatattcatggacttatctctgccgatcgctattccctgttccttgtctgtgag
gacagctccaacgacaagtttcttatcagccgcctgtttgatgttgcagaaggttcaaca
ctggaagaagcttcaaataactgtatccgcttagaatggaacaaaggcattgtgggacac
gtggcagcatttggtgagcccttaaacatcaaagatgcttacgaggatcctcgattcaat
gcagaagttgaccaaattacaggctacaggacacaaagtattctttgtatgccgattaag
aatcatagggaagaggttgttggtgtagcccaggccatcaacaagagatcgggaaatggt
gggacattcactgaaaaagatgaaaaggactttgctgcctatttggcattttgtggtatt
gttcttcataatgctcaactctatgagacttcactgctggagaacaagagaaatcaggtg
ctgcttgaccttgctagcttaatttttgaagaacaacaatcattagaagtaattctaaag
aaaatagctgccactattatctctttcatgcaggtgcagaaatgcaccattttcatagtg
gatgaagattgctccgattctttttctagtgtgtttcacatggagtgtgaagaattagaa
aaatcatcagatactttaacaagggagcgtgatgcaaacagaatcaattacatgtatgct
cagtatgtaaaaaatactatggaaccacttaatatcccagatgtcagtaaagacaaaaga
tttccctggacaaatgaaaacacaggaagcgtaagtcaacagttcattagaagtttgctt
tgtacgcctataaaaaatggaaagaagaataaagtgataggggtttgccaacttgtaaat
aagatggaggagaatactggcaaggttaagcctttcaaccgaaatgacgaacagtttctg
gaggcttttgtcatcttttgtggcttggggatccagaacacacagatgtatgaagcagtg
gagagagccatggccaagcaaatggtcacactggaggttctgtcgtatcacgcttcagca
gcagaggaagaaacaagagagctccaatccttagcggctgctgttgtaccatctgctcag
acacttaaaattactgacttcagtttcagtgactttgagctgtctgacctagaaacggca
ctgtgtacaattcggatgttcactgacctcaaccttgtgcagaacttccagatgaaacat
gaggttctttgcaggtggattttaagtgttaagaagaattaccggaagaatgttgcctat
cataattggagacacgcctttaatacagctcagtgcatgtttgctgctctaaaagcaggc
aagattcagaacaagctgaccgacctggagacactcgccctgctgattgctgctctcagc
cacgacttggaccaccgtggtgtgaataactcttacatacagcgaagtgaacacccactt
gctcagctctactgccattcgatcatggagcatcatcattttgaccagtgcctgatgatt
cttaatagtccaggcaatcagattctcagtggcctctccatcgaagaatataagaccacg
ctgaaaataatcaagcaagctattttagctacagacctagcgctgtatattaagagacga
ggagaattttttgaacttataagaaaaaatcaattcaacttggaagatcctcatcaaaaa
gagttgtttttagcgatgttgatgacagcttgtgatctctctgcaattacaaaaccctgg
cctattcaacaacggatagcagaacttgtagcaactgaattttttgaccaaggagacaga
gagagaaaagaactcaacatagagcctgctgatctgatgaacagggagaagaaaaacaaa
atcccaagtatgcaagttgggttcatagatgccatctgcttgcaactatatgaggccttg
acccacgtttctgaggactgtttccctttgctggatggctgcaggaagaacaggcaaaaa
tggcaggctcttgcagaacagcaggagaaaatgctgattaatggggaaagcagccaggcc
aagcggaactga

DBGET integrated database retrieval system