KEGG   Felis catus (domestic cat): 101080285Help
Entry
101080285         CDS       T02385                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, Cw-12 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101080285
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101080285
   04145 Phagosome
    101080285
  09143 Cell growth and death
   04218 Cellular senescence
    101080285
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101080285
   04612 Antigen processing and presentation
    101080285
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101080285
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101080285
   05330 Allograft rejection
    101080285
   05332 Graft-versus-host disease
    101080285
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101080285
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101080285
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080285
   05170 Human immunodeficiency virus 1 infection
    101080285
   05168 Herpes simplex virus 1 infection
    101080285
   05163 Human cytomegalovirus infection
    101080285
   05167 Kaposi sarcoma-associated herpesvirus infection
    101080285
   05169 Epstein-Barr virus infection
    101080285
   05165 Human papillomavirus infection
    101080285
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101080285
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101080285
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101080285
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101080285
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 C2-set_2 ig Ig_2 Darcynin
Motif
Other DBs
NCBI-GeneID: 101080285
NCBI-ProteinID: XP_023110475
Position
B2
AA seq 340 aa AA seqDB search
MTQTQFTLLLVSGFRGNQRHCKFPCYQVSAPDPATNCESFSPDPEGAGHYAPNPPPAAVG
GPGHDPDLGGLPLPQVFLHRRVPTRPRGAPLLGSRLRRRQAVRTVRQRCPKSEGRAAAQW
LEQEGPEYWDRETLRVKETAQISRVSLQTALGYYNQSESGSHTLQDMYGCDVGPDGRFLR
GYSQLAYDGEDYIALNEDLCSWTAADTAAQITRRKWEVAGVAEDFRNYAEECAWIGSAES
PKTRVTRHPISDREVTLRCWALGFYPAEITLTWQRDGQDHTQDTELVDTRPAGDGTFQKW
AAVVVPSGEEQRYTCHVQHEGLPEPITLRWEPIPQPQPGA
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgacgcaaactcagttcacactcctattagtgtcgggtttccggggaaaccagcggcac
tgcaagttcccctgttaccaagtctccgcacccgaccccgctaccaactgcgaatcattc
tctccagaccctgaaggagcgggtcattatgccccgaaccctcctcctgctgctgtcgga
ggccctggccatgacccagacctgggcgggctcccactccctcaggtatttctccaccgt
cgtgtcccgacccggccgcggggagccccgctacttggaagtcggctacgtagacgacaa
gcagttcgtacggttcgacagcgatgccccaagtccgagggtagagccgcggcgcagtgg
ttggagcaggaggggccagagtattgggaccgggagacgctgagggtcaaggagacagca
cagatttcccgagtgagcctgcagactgccctcggctactacaaccagagcgagtccggg
tctcacaccttacaggatatgtatggctgtgacgtggggccagacgggcgcttcctccgc
gggtacagtcagttggcctacgacggcgaggattacatcgccctgaacgaggacctgtgc
tcctggaccgcggcggacaccgcggcgcagatcacccgccgcaagtgggaggtggccggt
gtggcggaagacttcaggaactacgcggaggaatgtgcttggattggctccgcagaatct
cccaaaacacgggtgacccgccaccccatctctgaccgtgaggtgaccctgaggtgctgg
gctctgggcttctaccctgcggagatcaccctgacctggcagcgtgatgggcaggaccac
acccaggacacagagcttgtggacaccaggcctgcgggagatggaaccttccagaagtgg
gcggctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcagcacgag
gggctgcccgagcccatcaccttgagatgggaaccaatcccacagccacagccgggggcc
tga

KEGG   Felis catus (domestic cat): 101080790Help
Entry
101080790         CDS       T02385                                 

Definition
(RefSeq) BOLA class I histocompatibility antigen, alpha chain BL3-7-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101080790
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101080790
   04145 Phagosome
    101080790
  09143 Cell growth and death
   04218 Cellular senescence
    101080790
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101080790
   04612 Antigen processing and presentation
    101080790
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101080790
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101080790
   05330 Allograft rejection
    101080790
   05332 Graft-versus-host disease
    101080790
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101080790
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101080790
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080790
   05170 Human immunodeficiency virus 1 infection
    101080790
   05168 Herpes simplex virus 1 infection
    101080790
   05163 Human cytomegalovirus infection
    101080790
   05167 Kaposi sarcoma-associated herpesvirus infection
    101080790
   05169 Epstein-Barr virus infection
    101080790
   05165 Human papillomavirus infection
    101080790
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101080790
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101080790
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101080790
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101080790
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I
Motif
Other DBs
NCBI-GeneID: 101080790
NCBI-ProteinID: XP_023109512
Ensembl: ENSFCAG00000000629
Position
B2
AA seq 221 aa AA seqDB search
MRFVMPRTLLLLLSEALAVTQTRAGSHSLRYFYTAVSRPGRGEPRFISVGYVDDTQFVRF
DSDAPNPREEPRAPWMEQEGPEYWDEQTRMVKDHAQTFRLSLNNLRGYYNQSVSESHSLQ
RMYGCDIGPDGRLLRGYSQDAYDGEDYIALNEDLRSWTAADTAAQITRRKWEVAGEAERW
RNYLEGTCVEGLPKYLEMGKETLLRAGTGTAGLPRWPLHWG
NT seq 666 nt NT seq  +upstreamnt  +downstreamnt
atgaggttcgtcatgccccgaaccctcctcctgctgctatcggaggccctggccgtgacc
cagaccagggcgggctcccactccctgaggtatttctacaccgcggtgtcccggcccggc
cgcggggagccccgcttcatctccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccccgaatcccagggaagagccgcgggcgccgtggatggagcaggagggg
ccggagtattgggacgagcagacgcggatggtcaaggaccacgcacagactttccgactg
agcctgaacaacctgcgcggctactacaatcagagcgtgtccgagtcgcacagcctccag
agaatgtatggctgtgacatcgggcctgacggccgcctcctccgcgggtacagtcaggac
gcctacgacggcgaggattacatcgccctgaacgaggacttgcgctcctggaccgcggcg
gacaccgcggcgcagatcacacgccgcaagtgggaggtggccggtgaggcggagcgctgg
aggaactacctggagggcacatgcgtggaggggctccccaaatacctggagatggggaag
gagacgttgctgcgcgcaggtaccgggaccgctgggcttccccgatggcccctccactgg
ggctga

KEGG   Felis catus (domestic cat): 101081297Help
Entry
101081297         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0101 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101081297
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101081297
   04145 Phagosome
    101081297
  09143 Cell growth and death
   04218 Cellular senescence
    101081297
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101081297
   04612 Antigen processing and presentation
    101081297
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101081297
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101081297
   05330 Allograft rejection
    101081297
   05332 Graft-versus-host disease
    101081297
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101081297
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101081297
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101081297
   05170 Human immunodeficiency virus 1 infection
    101081297
   05168 Herpes simplex virus 1 infection
    101081297
   05163 Human cytomegalovirus infection
    101081297
   05167 Kaposi sarcoma-associated herpesvirus infection
    101081297
   05169 Epstein-Barr virus infection
    101081297
   05165 Human papillomavirus infection
    101081297
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101081297
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101081297
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101081297
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101081297
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 ig C2-set_2 Darcynin
Motif
Other DBs
NCBI-GeneID: 101081297
NCBI-ProteinID: XP_023109511
Position
B2
AA seq 364 aa AA seqDB search
MGFIEPQTLLLLLSGALAVTETWAGSHSLRYFDTIVSRPGLGEPRFIAVGYVDDTQFERL
DSDTPNPRAEPRAPWVEKEGPQYWDRNTRIYLDTAQVSRVNLNMMLRCYNQSDSGSHNIQ
RMYGCDVDQGPDGRLLRGYSQESYDGADYISLNEDLRSWTAADTAAQMTRRKWEAAGVTK
DFRNYLEVTCLEWLRRHLENGQETLQHTESPNTRVTRHPISDREVTLRCWALGFYLAEIT
LTWQSDGEDHTQDTELVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVQHEGLPEPITLRW
EPSSLPSIPIPGIMAGVAILVVTVVVGAVIWRKKFSGGKGPSYSPAACNGSTQGSDSSLM
APKV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggggttcatagaaccccaaacgctcctcctgctgctgtcgggggccttggccgtgact
gagacctgggcgggctcccactccctgaggtatttcgataccatcgtgtcccggcccggt
ctcggggaaccccgcttcatcgccgtgggctacgtggacgacacgcagttcgagcggtta
gacagcgacaccccgaatccaagggctgagccgcgggcgccatgggtggagaaggagggg
ccgcagtattgggaccggaacacccggatttacttggacaccgcacaagtttcccgagtg
aacctgaacatgatgctccgctgctacaaccagagcgattccggatcacacaacatccag
agaatgtacggctgtgacgtggaccaggggccagacggccgcctcctccgcgggtacagt
caggagtcctacgacggcgcggattacatctccctgaacgaggacctgcgctcctggacc
gcggcggacaccgcagcgcagatgacacgccgcaagtgggaggcggctggtgtgactaag
gacttcaggaactacctggaggtcacgtgcctggagtggctccgcaggcacctggaaaac
gggcaggagacgctgcagcacacagagtctcccaacacacgcgtgacccgccaccccatc
tctgaccgtgaggtgaccctgaggtgctgggccctgggcttctaccttgcagagatcacc
ctgacctggcagagtgatggggaggaccacacccaggacacagagcttgtggagaccagg
cctgcaggagatgggaccttccagaagtgggcagctgtggtggtatcttctggagaggag
cagagatacacgtgccatgtgcagcacgaggggctgcccgagcccatcaccctgagatgg
gaaccatcctctctgccctccatccccatcccgggcatcatggctggtgtggctatcctt
gtggtcactgtggtggttggagctgtgatctggaggaagaagttctcaggaggaaaagga
ccaagctactctcctgctgcatgcaatggcagtacccagggctctgattcgtctctaatg
gctcctaaagtgtga

KEGG   Felis catus (domestic cat): 101094232Help
Entry
101094232         CDS       T02385                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101094232
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101094232
   04145 Phagosome
    101094232
  09143 Cell growth and death
   04218 Cellular senescence
    101094232
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101094232
   04612 Antigen processing and presentation
    101094232
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101094232
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101094232
   05330 Allograft rejection
    101094232
   05332 Graft-versus-host disease
    101094232
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101094232
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101094232
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094232
   05170 Human immunodeficiency virus 1 infection
    101094232
   05168 Herpes simplex virus 1 infection
    101094232
   05163 Human cytomegalovirus infection
    101094232
   05167 Kaposi sarcoma-associated herpesvirus infection
    101094232
   05169 Epstein-Barr virus infection
    101094232
   05165 Human papillomavirus infection
    101094232
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101094232
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101094232
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101094232
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101094232
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set ig C2-set_2 MHC_I_3 Ig_3
Motif
Other DBs
NCBI-GeneID: 101094232
NCBI-ProteinID: XP_023109696
Position
A1
AA seq 392 aa AA seqDB search
MLLLLQLLSLLRELTAESPWGLPVVADGPASLAKVVMAELADLKLENKPWPGGTHSLHYH
YLALSEPGPDLPQFLAVGYVDDQPFIHYDSRVDRAKPQAPWMAAVDTQYWETETQKQRAW
AKVQQVETWTVMGYHNQSSGTHSTQRTFGCEIREDGCTSSFWQFGFDGQDHLSLDLETLS
WVSAKPVAVQTKRWWETERCYAEYDKAYLEGLCLTSLHRYLELGSQSLTRKEPPKVQVTR
HTAEDGSITLRCWARGFYPRDISLSWWLGEEELVQETEYVETRPGGDGTYQTWAAVRVPA
RMENGYICHVQHSSLNHTLTVAWEAPSHQWITSAKVISIIFTITFLLVAGVLTFIKQYSQ
ARNKESCKQAPGGEEPHNSQNPMSVEAAQLLC
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgctgctgctgctgcaactgctgtcgctactgcgggagctcacggcagagagtccctgg
gggctgcctgtggtagctgatggcccagcttccttagcaaaggtggtgatggcagaactg
gctgacctgaagttagaaaacaagccatggcctggagggacacactctctccactaccac
tacctggccctatcagagccaggcccggaccttcctcagtttctggctgtaggctacgtg
gacgaccagcctttcatccattatgacagtcgtgtggacagagccaagccccaggccccg
tggatggcagctgtggacacccagtactgggaaacagagacccagaagcagagagcctgg
gcaaaggtgcagcaggtggagacatggactgtgatgggctaccacaaccagagcagtggc
acacacagcactcagcgaacgttcggctgtgagatccgggaagacggctgtaccagcagc
ttctggcagtttggctttgatggccaggaccacctgtcactggacctggagactctgagc
tgggtgtcagccaagcctgtggctgtgcagaccaagcgttggtgggaaacagagcgctgc
tatgccgaatacgacaaggcctacctggagggcctctgcctcacttccctgcacaggtac
ctggagctgggcagccagagcctcacccggaaagagccgcccaaagtgcaagtgacaaga
cacacagctgaggatgggagcatcacactgagatgctgggcccggggcttctacccacgg
gacatctcattgagctggtggctgggggaggaggaactggttcaagagaccgagtatgtg
gagacacgccccggtggagacggtacctaccagacatgggcggccgtgcgggtgccagcc
aggatggagaatgggtacatttgccatgtgcagcactccagcttgaaccatacactcact
gtggcctgggaagcaccctctcatcagtggataaccagtgccaaggttatctccatcatc
ttcaccatcactttcttgctggtggctggagttttgactttcatcaagcagtactctcaa
gccaggaataaggaatcttgcaaacaagccccaggtggagaggagcctcataattcccaa
aacccaatgagcgtggaggctgctcagctgctctgctga

KEGG   Felis catus (domestic cat): 101095479Help
Entry
101095479         CDS       T02385                                 

Gene name
FLAI-K
Definition
(RefSeq) saoe class I histocompatibility antigen, A alpha chain-like precursor
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101095479 (FLAI-K)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101095479 (FLAI-K)
   04145 Phagosome
    101095479 (FLAI-K)
  09143 Cell growth and death
   04218 Cellular senescence
    101095479 (FLAI-K)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101095479 (FLAI-K)
   04612 Antigen processing and presentation
    101095479 (FLAI-K)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101095479 (FLAI-K)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101095479 (FLAI-K)
   05330 Allograft rejection
    101095479 (FLAI-K)
   05332 Graft-versus-host disease
    101095479 (FLAI-K)
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101095479 (FLAI-K)
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101095479 (FLAI-K)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101095479 (FLAI-K)
   05170 Human immunodeficiency virus 1 infection
    101095479 (FLAI-K)
   05168 Herpes simplex virus 1 infection
    101095479 (FLAI-K)
   05163 Human cytomegalovirus infection
    101095479 (FLAI-K)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101095479 (FLAI-K)
   05169 Epstein-Barr virus infection
    101095479 (FLAI-K)
   05165 Human papillomavirus infection
    101095479 (FLAI-K)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101095479 (FLAI-K)
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101095479 (FLAI-K)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101095479 (FLAI-K)
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101095479 (FLAI-K)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C C2-set_2 Ig_3 MHC_I_3 ig Ig_2 EphA2_TM Protocadherin Darcynin
Motif
Other DBs
NCBI-GeneID: 101095479
NCBI-ProteinID: NP_001291958
Ensembl: ENSFCAG00000005611 ENSFCAG00000027242
UniProt: S4Z3H8
Position
B2
AA seq 362 aa AA seqDB search
MRFLMSRTVLLLLLGALAAPQTWAGSHSLRYFYTAMSRPGLGEPRFIAVGYVDDTQFVRF
DSDAPNPRMEPRAPWVEQVGPEYWDQETRNEKNNAQIFRVDLNTMLRYYNQSESGSHNIQ
WMYGCDVGPDRRFLRGYSQDSYDGKDYIALNEDLRSWTAADTAAQITRRKWEEAGAAEQE
RNYLEGTCVEWLAKYLDMGKETLLRAESPNTRVTRHPISDREVTLRCWALGFYPAEITLT
WQRDGQDHTQDAELVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVQHEGLREPITLRWEP
SSQPSIPILGIIAGVAVLVVIVVVGAVIWRKKFSGGKGPRYSHAARDDSTQGSDSSVMAP
KV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcggttcctgatgtcccgaactgtgctcctgctgctgttgggggccctggccgcgccc
caaacctgggcgggctcccactccctgaggtatttctacaccgcgatgtcccggcccggc
ctcggggagccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacagcgacgccccgaatccgaggatggagccgcgggcgccgtgggtggagcaggtgggg
ccggagtattgggaccaggagacgcggaacgagaagaacaacgcacagattttccgagtg
gacctgaacacgatgctccgctactacaaccagagcgagtccgggtcgcacaacatccag
tggatgtatggctgtgacgtgggcccagaccggcgcttcctccgcggatacagtcaggac
tcctatgacggcaaggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacaccgcggcgcagatcacacgccgcaagtgggaggaggccggtgcggcggagcaggag
aggaactacctggagggcacgtgcgtggagtggctcgccaaatacctggacatggggaag
gagacgctgctgcgcgcagaatctcccaacacacgcgtgacccgccaccccatctctgac
cgtgaggtgaccctgaggtgctgggctctgggcttctaccctgcggagatcaccctgacc
tggcagcgtgatgggcaggaccacacccaggacgcagagcttgtggagaccaggcctgcg
ggagatgggaccttccagaagtgggcagctgtggtggtgtcttctggagaggagcagaga
tacacgtgccatgtgcagcacgaggggctgcgcgagcccatcaccttgagatgggagcca
tcctctcagccctccatccccatcctgggcatcattgctggtgtggctgtccttgtggtc
attgtggtggttggagctgtgatctggaggaagaagttctcaggaggaaagggaccacgc
tattctcacgctgcacgtgatgacagtactcagggctctgattcgtctgtaatggctcct
aaagtgtga

KEGG   Felis catus (domestic cat): 101099296Help
Entry
101099296         CDS       T02385                                 

Definition
(RefSeq) H-2 class I histocompatibility antigen, Q10 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    101099296
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101099296
   04145 Phagosome
    101099296
  09143 Cell growth and death
   04218 Cellular senescence
    101099296
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101099296
   04612 Antigen processing and presentation
    101099296
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101099296
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101099296
   05330 Allograft rejection
    101099296
   05332 Graft-versus-host disease
    101099296
  09166 Cardiovascular disease
   05416 Viral myocarditis
    101099296
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    101099296
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101099296
   05170 Human immunodeficiency virus 1 infection
    101099296
   05168 Herpes simplex virus 1 infection
    101099296
   05163 Human cytomegalovirus infection
    101099296
   05167 Kaposi sarcoma-associated herpesvirus infection
    101099296
   05169 Epstein-Barr virus infection
    101099296
   05165 Human papillomavirus infection
    101099296
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101099296
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    101099296
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101099296
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  101099296
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set Ig_3 Ig_2
Motif
Other DBs
NCBI-GeneID: 101099296
NCBI-ProteinID: XP_019685886
Position
B2
AA seq 373 aa AA seqDB search
MTRPQFALPLLVLCLEKPISVTAVPGLSWPRTRWDFYSPDPEDAGRDAPNPPLAAVGGPG
RDPDLRGLGEPRYLEVGYVDDTQFARFDSDASSPRMEPRVHWLKQEAPGYWEQETRGAKD
TAQTFRLSLNTLRGYYNQSEAGSHTIQWLSSCEVGPDWRLLRGYWQFAYDGEDYIALNED
LRSWTAADTAAQITRRKWEAAGAAEHQRNDLQVTCVEWLRKYLERGNKTLLRTDPPKTHI
THYPTSDHDVTLKCWALGFYPAEITLTWQRDGEDLIQETEVPFSAHYSHGGHCCWSGFLC
GHQCCGGWSCHMEEVEPRWKRKELCSVCMSSMWSPAWQSLTPCLTGRMLGQQVLPLLWRE
AASSKDSKCGILM
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atgacgcggccccagttcgcactcccattgcttgtcctgtgtctagagaagccaatcagc
gtcaccgcggtccctggcctgtcctggccacggacccgctgggacttctattctccagac
cctgaggatgcgggtcgtgatgccccgaaccctcctcttgctgctgtcgggggccctggc
cgtgacccagacctgcgcggcctcggggagccccggtacttggaagtcggctacgtggac
gacacacagttcgcgcggttcgacagcgacgcctcgagtccgaggatggagccacgcgtg
cattggttgaagcaggaggcgccggggtattgggagcaggagacgcggggcgccaaggac
accgcacagactttccgactgagcctgaacacgctgcgcggctactacaaccagagcgaa
gccgggtctcacaccatccagtggctgtcttcctgcgaagtggggcccgattggcgcctc
ctccgaggatactggcagttcgcctatgacggcgaggattacatcgccctgaacgaggac
ctgcgctcttggaccgcggcggacacggcggcgcagatcacccgccgcaagtgggaggct
gccggagcagccgagcatcaaaggaacgacctgcaggtcacatgcgtagagtggctccgg
aagtacttggagagggggaacaagacgctgctgcgcacagaccccccgaagacacacatc
acccactaccccacttctgaccatgatgtcaccctgaagtgctgggccctgggtttctat
cctgcggagatcaccctaacctggcagcgtgatggggaggacctgatccaggaaacggaa
gtccccttctcagcgcattattcccatggtgggcattgttgctggtctggtttcctttgt
ggtcatcagtgctgtggtggttggagctgtcatatggaggaggtagagccaaggtggaag
agaaaggagttatgctcagtctgcatgtccagcatgtggtcacctgcctggcagagcctc
acgccatgtctaactggaaggatgttgggacagcaggtccttcctcttctatggagagag
gcggcgtcttccaaagactctaaatgtggaattctcatgtag

KEGG   Felis catus (domestic cat): 105260551Help
Entry
105260551         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: class I histocompatibility antigen, Gogo-B*0101 alpha chain
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    105260551
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    105260551
   04145 Phagosome
    105260551
  09143 Cell growth and death
   04218 Cellular senescence
    105260551
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    105260551
   04612 Antigen processing and presentation
    105260551
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    105260551
  09163 Immune disease
   05320 Autoimmune thyroid disease
    105260551
   05330 Allograft rejection
    105260551
   05332 Graft-versus-host disease
    105260551
  09166 Cardiovascular disease
   05416 Viral myocarditis
    105260551
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    105260551
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    105260551
   05170 Human immunodeficiency virus 1 infection
    105260551
   05168 Herpes simplex virus 1 infection
    105260551
   05163 Human cytomegalovirus infection
    105260551
   05167 Kaposi sarcoma-associated herpesvirus infection
    105260551
   05169 Epstein-Barr virus infection
    105260551
   05165 Human papillomavirus infection
    105260551
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    105260551
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    105260551
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   105260551
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  105260551
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig SP_C-Propep DUF4448 MHC_I_3 EphA2_TM Ig_2 Darcynin
Motif
Other DBs
NCBI-GeneID: 105260551
NCBI-ProteinID: XP_011280416
Position
B2
AA seq 362 aa AA seqDB search
MRVVMPRTLLLLLSGALAVTQTWAGSHSLRYFHTAMSRPGLGEPRFIAVGYVDDTQFVRF
DTDAPNPRMEPRAPWMEQVGPEYWDRETRIAKVHAEIARPNLQTALRYYNQSESGSHSIQ
RMHGCDIGADGRLLRGYSQLAYDGADYIALNEDLRSWTAADTAAQITRRKWEVAGEAARY
RKYLEDTCLAGLRRYLEMGKETLLRAESPKTHVTRHRISDHEVTLRCWALGFYPAEITLT
WQHDGQDHTQDTELVETRPAGDGTFQKWAAVVVSSGEEQRYTCHVQHEGLPEPITLRWEP
SSQPSIPILGIIVAVVVLVVIVVVGAVIWRKKFSAEKGPSYSHAARNDSIQGSDSSLMAP
KV
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcgggttgttatgccccgaacgctcctcctgctgctgtcgggggccctggccgtgacc
cagacctgggcaggctcccactccttgaggtatttccacaccgcgatgtcccggcccggc
ctcggggaaccccgcttcatcgccgtgggctacgtggacgacacgcagttcgtgcggttc
gacaccgacgccccaaatccgaggatggagccgcgggcgccgtggatggagcaggtgggg
ccagagtattgggaccgggagacgcggatcgccaaggtgcacgcagagattgcccgaccg
aacctgcagaccgccctccgctactacaaccagagcgagtccgggtcacacagcatccag
agaatgcatggctgtgacatcggggccgacggacgcctcctccgcgggtacagtcagttg
gcctacgacggcgcggattacatcgccctgaacgaggacctgcgctcctggaccgcggcg
gacaccgcggcgcagatcacacgccgcaagtgggaggtggccggtgaggcggcgcgctat
aggaagtacctggaggacacgtgcttggcggggctccgcaggtacctggagatggggaag
gagacgctgctgcgtgcagagtctcccaaaacacacgtgacccgccaccggatctctgac
catgaggtgaccctgaggtgctgggccttgggcttctaccctgcggagatcaccctgacc
tggcagcatgatgggcaggaccacacccaggacacagaacttgtggagacaagacctgcg
ggagatgggaccttccagaagtgggcggctgtggtggtgtcttctggagaggagcagaga
tacacgtgccatgtgcagcacgaggggctgcccgagcccatcaccttgagatgggagcca
tcctctcagccctccatccccatcctgggcatcattgttgctgtggttgtccttgtggtc
attgtggtggttggagctgtgatctggaggaagaagttctcagcagaaaaaggaccgagc
tactctcatgctgcacgcaatgacagtattcagggctccgattcatctctaatggctcct
aaagtgtga

KEGG   Felis catus (domestic cat): 111556177Help
Entry
111556177         CDS       T02385                                 

Definition
(RefSeq) HLA class I histocompatibility antigen, B-45 alpha chain-like isoform X1
  KO
K06751  MHC class I antigen
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
fca04145  Phagosome
fca04218  Cellular senescence
fca04514  Cell adhesion molecules (CAMs)
fca04612  Antigen processing and presentation
fca04940  Type I diabetes mellitus
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05203  Viral carcinogenesis
fca05320  Autoimmune thyroid disease
fca05330  Allograft rejection
fca05332  Graft-versus-host disease
fca05416  Viral myocarditis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04514 Cell adhesion molecules (CAMs)
    111556177
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111556177
   04145 Phagosome
    111556177
  09143 Cell growth and death
   04218 Cellular senescence
    111556177
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    111556177
   04612 Antigen processing and presentation
    111556177
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    111556177
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111556177
   05330 Allograft rejection
    111556177
   05332 Graft-versus-host disease
    111556177
  09166 Cardiovascular disease
   05416 Viral myocarditis
    111556177
  09167 Endocrine and metabolic disease
   04940 Type I diabetes mellitus
    111556177
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111556177
   05170 Human immunodeficiency virus 1 infection
    111556177
   05168 Herpes simplex virus 1 infection
    111556177
   05163 Human cytomegalovirus infection
    111556177
   05167 Kaposi sarcoma-associated herpesvirus infection
    111556177
   05169 Epstein-Barr virus infection
    111556177
   05165 Human papillomavirus infection
    111556177
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    111556177
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
    111556177
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   111556177
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:fca00537]
 Antigens
  111556177
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MHC_I C1-set MHC_I_C Ig_3 C2-set_2 ig EphA2_TM
Motif
Other DBs
NCBI-GeneID: 111556177
NCBI-ProteinID: XP_023105358
Position
B2
AA seq 374 aa AA seqDB search
MRVVMPPTLLLLSGALAVTQTWAGSHSLRYFHTAMSRPGRGEPRFISVGYVDDTQFVRFD
TDALNPRSEPRARWMEQVGSEYWDQETRNAKDNAQKFRVSLQNMRGYYNQSDSGFTLITA
ALGAGTGSHNIQWMYGCDIGPNSRLLRGYSQVSYDGKDYIALNEDLGSWTAADTAAQITR
HTWEVACAAEHYRNYLEGVCVESLTKYLEMGKERLLRAESPQTRVTRHPISDREVTLRCW
ALGFYLAEITLTWQSDGEDHTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHE
GLPEPITLRWEPSSQPSIPILGIIAGVAVLVVTVVVGAVIWRKKFSGRKGPSYSHAARDD
STQGSDSSLMAPKV
NT seq 1125 nt NT seq  +upstreamnt  +downstreamnt
atgcgggtcgtgatgcccccaactctactgctgctgtcgggggccctggccgtgacccag
acctgggcgggctcccactccctgaggtatttccacaccgcgatgtcccggcccggccgc
ggggagccccgcttcatctccgtgggctacgtggacgacacgcagtttgtgcggttcgac
accgacgccctgaatccaaggtctgagccgcgggcgcggtggatggagcaggtggggtca
gagtattgggaccaggagacgcggaacgcgaaggacaacgcacagaaatttcgagtgagc
ctgcagaacatgcgcggctactacaaccagagcgattccggtttcaccttaatcactgct
gctctgggggcggggacaggatcacacaacatccagtggatgtatggctgtgacatcgga
ccgaacagccgcctcctccgcgggtacagtcaggtgtcctatgacggcaaggattacatc
gccctgaacgaggacctgggctcctggaccgcggcggacaccgcggcgcagatcacccgc
cacacgtgggaggtggcctgtgctgcagagcactacaggaactacctggagggcgtgtgc
gtggagtcgctcaccaaatacctggagatggggaaggagaggctgctgcgcgcagaatct
ccccaaacacgggtgacccgccaccccatctctgaccgtgaggtgaccctgaggtgctgg
gccctgggcttctaccttgcagagatcaccctgacctggcagagtgatggggaggaccac
acccaggacacagagcttgtggagaccaggcctgcaggagatggaaccttccagaagtgg
gcggctgtggtggtgccttctggagaggagcagagatacacgtgccatgtgcagcacgag
gggctgcccgagcccatcaccctgagatgggagccatcctctcagccctccatccccatc
ctgggcatcattgctggtgtggctgtccttgtggtcactgtggtggttggagctgtgatc
tggaggaagaagttttcaggaagaaaaggaccaagctactctcatgctgcacgcgatgac
agtacccagggctctgattcgtctctcatggctcctaaagtgtga

DBGET integrated database retrieval system