KEGG   Felis catus (domestic cat): 101080339Help
Entry
101080339         CDS       T02385                                 

Gene name
CACNG5
Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04921  Oxytocin signaling pathway
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101080339 (CACNG5)
 09150 Organismal Systems
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101080339 (CACNG5)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101080339 (CACNG5)
   04261 Adrenergic signaling in cardiomyocytes
    101080339 (CACNG5)
 09160 Human Diseases
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101080339 (CACNG5)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101080339 (CACNG5)
   05414 Dilated cardiomyopathy (DCM)
    101080339 (CACNG5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101080339 (CACNG5)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101080339 (CACNG5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 SUR7 DUF716 DHHC
Motif
Other DBs
NCBI-GeneID: 101080339
NCBI-ProteinID: XP_023099617
Position
E1
AA seq 275 aa AA seqDB search
MSGCGRKALTLLSSVFAVCGLGLLGIAVSTDYWLYLEEGVVLPQNQSMEIKMSLHSGLWR
VCFLAGEERGRCFTIEYVMPMNTQLTSESTVNVLKMIRSATPFPLVSLFFMFIGFILSNI
GHIRPHRTILAFVSGIFFILSGLSLVVGLVLYISSINDEMLNRTRDTETYFNYKYGWSFA
FAAISFLLTESAGVMSVYLFMKRYTAEDMYRPHPGFYRPRLSNCSDYSGQFLHPDAWVRG
RSPSDISSDASLQMNSNYPALLKCPDYDQMSSSPC
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgagtggctgcgggaggaaggccctgaccctgctgagcagcgtctttgctgtctgtggc
ctgggtctcctgggcattgcggtcagcactgactactggctgtacctggaggagggcgtg
gtcctgccccagaaccagagcatggagatcaagatgtccctgcactccggcctgtggcgt
gtctgcttcctcgcaggtgaggagcggggccgctgtttcaccatagagtatgtgatgccc
atgaacacccagctgacatcagagtccaccgtcaacgttttaaaaatgattcgttcggcc
acaccattccctctggtcagcctcttcttcatgttcattgggtttatcctgagcaacatc
ggacacatccgtccccataggactatactggcctttgtctccggcatcttttttattctc
tcaggcctctctctggtggtgggcctggtgctctacatctccagcatcaacgatgagatg
ctcaacaggaccagggacacggagacgtatttcaactacaagtatgggtggtcgtttgcc
ttcgctgccatctccttcctgttgacagagagcgctggggtgatgtccgtgtacctgttc
atgaagaggtacaccgccgaggacatgtacaggcctcaccccggcttctaccgtccccgt
ctgagcaactgctccgattactcaggccagttcctgcacccggacgcctgggtccggggc
cgcagcccatctgacatctccagtgacgcctccctgcagatgaacagcaactacccagcc
ttgctcaagtgccccgactatgaccagatgtcatcctccccctgctga

DBGET integrated database retrieval system