KEGG   Felis catus (domestic cat): 101080381Help
Entry
101080381         CDS       T02385                                 

Gene name
NOTCH4
Definition
(RefSeq) LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 4
  KO
K20996  Notch 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101080381 (NOTCH4)
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101080381 (NOTCH4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101080381 (NOTCH4)
   05206 MicroRNAs in cancer
    101080381 (NOTCH4)
  09162 Cancer: specific types
   05224 Breast cancer
    101080381 (NOTCH4)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101080381 (NOTCH4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101080381 (NOTCH4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF Ank_5 Ank_2 hEGF Ank Notch Ank_3 Ank_4 NODP NOD EGF_CA cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 101080381
NCBI-ProteinID: XP_023109527
Position
B2
AA seq 1214 aa AA seqDB search
MAPKGTSLLPLGSQQVPCCEGRTRPSCADNPCRNRATCQDGPQGPHCLCPPGYTGDSCQT
LVDICAQKPCPHNSHCLQTGPSFQCLCLQGWTGPLCNLPLSSCQKAALSQGTEVSSLCQN
GGLCIDSGSSYFCHCPPGFQGSVCQDRVNPCESRPCQHGATCMAQPTGYLCQCAPGYNGQ
NCSKESNACQSQPCHNHGTCTPKPGGFYCTCPPGFVGLRCEGDVDECLDQPCHPPGTAAC
HSLANAFYCQCLPGYTGQWCEVETDPCQSQPCSNGGSCETTAGPPLGFTCHCLQGFEGPT
CNHRAPSCGHHHCHHGGLCLPSPKPGFPPRCACLNGYGGPDCLTPPAPHGCGPPSPCLHN
GSCSEIPGLGSPAFRCSCPPSSPGPRCQRPGAKGCEGRGGDGACDAGCSGPGGNWDGGDC
SLGVPDPWKGCPSHSRCWLLFRDGQCHPQCDSAECLFDGYDCETPPACTPAYDQYCRDHF
HNEHCEKGCNTAECGWDGGDCRPKDGDSEWGPSLALLVVLSPPALDQQLLALARVLSLTL
RVGLWVRKDSDGKDMVYPYPGAQAEEELVGTLDPSHQERAAPQTQPGGKETDSLSTGFVV
VMGVDLSRCGPDHPASRCPWDPGLLLRFLAAMAAVGALEHLLPGPLLAAHPRAGTAPPTN
QLPWPVLCSPVAGVLLLALGALLVLQLIRRRRREHGALWLPPGFIRRPRTQPTPRRRRPP
LGEDSIGLKALKPEAEVDEDGVVMCSGTKEGEEAEEMASPSKCQLCPLRGDCQELPQAAM
LTPPQESEMDVPDVDTRGPDGVTALMSAVCCGGVESRTFQGSWLGSPEPWEPLLGGGACP
QAHTVGTGETPLHLAARFSRPTAARRLLEAGANPNQPDRAGRTPLHTAVAADAREVCQLL
LRSRQTAVDARTEDGTTALMLAARLAVEDLVEELIAAQADVGARDKWGKTALHWAAAVNN
ARAARSLLQAGADKDAQDGREQTPLFLAAREGAVEVAQLLLGLGAARGLRDHAGLAPGDI
ARQRNHWDLLTLLGGAGSLEARHKATPGREAEAFPRSRTASGSLPPRRGGALPRNRTLSA
GAGPRGGGACLQTQTLSLEWAARGGGAYSHCQSPSKGAGGGLSPGGRRFSPGMRGPRPNP
AVVPGRSGAASGGGGGASADDWPCDWVTLRACGSNTPIPPPCLTPSPERGSPQVAWDPPT
HQVTTLNAGGEGQK
NT seq 3645 nt NT seq  +upstreamnt  +downstreamnt
atggcccccaaaggtacttccttgctgcccctcgggtcccagcaggtgccttgctgtgag
ggaaggacccgtcctagctgtgcagacaacccctgtaggaacagggcaacctgccaagat
ggtcctcagggtccccactgcctctgcccccctggctacacaggagacagctgccagact
ctggtggacatctgtgcccagaagccctgtccacacaattcccactgcctccagactggg
ccctccttccagtgcctgtgcctccagggatggaccgggcctctctgcaaccttccactg
tcctcctgccagaaggccgctttgagccaaggcacagaagtttcttccctgtgccagaat
ggaggtctctgcatcgacagtggctcctcctatttctgccactgcccccctggattccaa
ggcagcgtatgtcaggacagggtgaacccatgtgagtccaggccctgccagcatggggcc
acgtgcatggcccagcccactgggtatctctgccagtgtgccccaggctacaatggacag
aactgctcaaaggaatccaacgcttgtcaatcccagccctgtcacaaccatgggacctgc
acccccaaacctggaggcttctactgcacctgccctccaggttttgtggggctgcgctgt
gaaggggacgtagatgagtgtctggaccagccctgccaccccccaggcactgcagcctgc
cactctctggccaatgccttctactgccaatgtctgcctggatacacgggccagtggtgt
gaagtggagacagacccttgccagagccagccctgctccaacggagggtcttgtgagaca
acagcaggaccacccctgggtttcacctgccactgcctccagggttttgagggccctacc
tgcaaccacagagccccctcctgtggccaccaccactgccaccatggtggcctgtgtctg
ccctcccccaagcctggcttcccaccccgctgtgcctgcctcaatggctacgggggccct
gactgcctgaccccacctgctcctcatggctgtggccctccttctccatgcctacacaat
ggcagttgctcagagatccctgggctggggtccccagccttccgatgctcctgccctccc
agctctccagggccccggtgtcagaggcctggagcaaagggatgtgagggcagaggtgga
gatggggcctgtgatgctggctgcagcggccctggaggaaattgggatgggggagactgc
tccctaggggttccggacccctggaagggctgtccttcccactcccggtgttggcttctc
ttccgggatggacagtgccacccacagtgtgactctgcagagtgtctgtttgatggctac
gactgtgagactcctccagcctgcactccagcctatgaccagtactgccgtgatcacttc
cacaacgagcactgcgagaaaggctgcaacactgcagaatgtggctgggatgggggtgac
tgcaggcccaaagatggagattcagaatgggggccctccctggccctgctggtggtgctg
agccccccagccctggaccagcagctgcttgccctggcccgggtgctatccctgactctg
agagtggggctctgggtaaggaaggacagtgatggcaaggacatggtgtacccctatcct
ggggcccaggccgaagaggagctagtaggaaccctggatccctctcatcaggagagagca
gcccctcaaacacagcctgggggcaaggaaacagactctctcagcactgggtttgtggta
gtgatgggtgtggatttgtcccgctgtggccctgaccaccctgcatcccgctgtccctgg
gaccctgggctcttgctccgcttccttgctgcaatggctgcagtgggggccctggagcac
ctactgccaggaccactgctggctgcccatcctcgtgctggcaccgcaccaccaaccaac
cagcttccctggcctgtgctgtgctcaccagtggctggggtgctcctcctggcccttggg
gctcttctcgtccttcagctcatccggcggcggcgccgtgagcatggggccctctggctg
ccccctgggttcattcgaaggcctcgaactcagcccactccccgcagacgccggcctccc
ctgggtgaagatagcatcggcctcaaggcactgaagccagaggcagaagttgatgaggat
ggagttgtgatgtgctcaggcaccaaagaaggcgaagaggctgaggaaatggcctcaccc
tccaagtgccagctctgtcctctgaggggtgactgtcaggagctcccccaggcagccatg
ctgactcctccccaggaatctgagatggatgtccctgacgtggatacccgtgggcctgat
ggggtgacagccctgatgtcagcagtttgctgtgggggagtggagtccaggaccttccag
gggtcatggttgggaagccctgaaccctgggaacctctgttgggtggaggggcctgtccc
caggctcacactgtgggtactggggagacacccctgcacctggctgcccgattctcccgg
ccaaccgctgcccgccgtctccttgaggctggagccaaccccaaccagccagaccgagca
gggcgcacccctcttcacaccgctgtggctgctgacgctcgggaggtttgccagctcctg
ctccgcagcagacagactgcagtggatgcgcggacagaggacgggaccacagccctgatg
ctggccgctaggctggcggtggaggacctggttgaagaactgattgcagcccaagcagat
gtgggggccagagataaatggggaaaaaccgcgctgcactgggccgccgccgtgaacaac
gcccgggccgcccgctcccttctccaggccggagccgataaagatgcccaggacggcagg
gagcagacgccgctgttcctggcggcccgagaaggggcggtggaagtagctcaactgctg
ctgggactaggagcggcccgaggactgcgggaccacgccgggctagcgcccggagacatc
gctcgccagcgtaaccactgggatctcctgacgctactggggggggcggggtcactggaa
gcgcgtcacaaagccacgcccggccgcgaggcggaagccttcccgcgctcgcgtaccgcg
tcgggaagcttgcccccgcgtcggggcggggctctgccgcgcaaccggacgctgtcagct
ggggctggtccgcgtgggggcggagcatgtctgcaaacccagactttgtcattagaatgg
gccgcgcgtgggggtggagcctattcgcattgccagagcccatcgaaaggagcaggaggc
ggcctgtcccccggaggccgtaggttttctccaggcatgcgcgggcctcggcccaaccct
gctgtagtgccaggaagatccggggccgcttccgggggcgggggtggggcctcagccgac
gattggccctgcgattgggtgaccctgagagcctgcggctccaacactccaatcccgcct
ccttgccttacgccgtccccggagcggggatcccctcaagtcgcctgggatcctccaacc
caccaagtaacaactttaaacgcgggaggcgagggtcaaaaatag

KEGG   Felis catus (domestic cat): 101088469Help
Entry
101088469         CDS       T02385                                 

Gene name
NOTCH3
Definition
(RefSeq) neurogenic locus notch homolog protein 3
  KO
K20995  Notch 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04371  Apelin signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101088469 (NOTCH3)
   04371 Apelin signaling pathway
    101088469 (NOTCH3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101088469 (NOTCH3)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101088469 (NOTCH3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088469 (NOTCH3)
   05206 MicroRNAs in cancer
    101088469 (NOTCH3)
  09162 Cancer: specific types
   05224 Breast cancer
    101088469 (NOTCH3)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101088469 (NOTCH3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101088469 (NOTCH3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Notch Ank Ank_2 Ank_5 EGF_2 NODP DUF3454 NOD Ank_3 Ank_4 FXa_inhibition cEGF EGF_3
Motif
Other DBs
NCBI-GeneID: 101088469
NCBI-ProteinID: XP_023102376
Ensembl: ENSFCAG00000000914
Position
A2
AA seq 2323 aa AA seqDB search
MGPGTRGRRRRRRPMSAPPPLPPVRALPLLLLLAGPGAAAPPCLDGSPCMNGGRCTQLPS
REAACLCPPGWVGERCQLEDPCHSGPCAGRGVCQSSVVAGTARFSCRCPRGFRGPDCSLP
DPCLSSPCAHGARCSVGPDGRYLCSCPPGYQGRSCRSDVDECRVGGPCRHGGTCLNTPGS
FRCQCPAGYTGPLCENAAVPCAPSPCRNGGTCRQSGDLTYDCACLPGFEGQNCEVNVDDC
PGHRCLNGGTCVDGVNTYNCQCPPEWTGQFCTEDVDECQLQPNACHNGGTCFNTLGGHSC
VCVNGWTGESCSQNIDDCATAVCFHGATCHDRVASFYCACPMGKTGLLCHLDDACVSNPC
HEDAICDTNPVNGRAICTCPPGFTGGACDQDVDECSIGANPCEHLGRCVNTQGSFLCQCG
RGYTGPRCETDVNECLSGPCRNQATCLDRIGQFTCICMAGFTGTYCEVDVDECQSSPCVN
GGVCKDRVNGFSCTCPSGFSGAMCQLDVDECASTPCRNGAKCVDQPDGYECRCAEGFEGT
LCERNVDDCSPDPCHHGRCVDGIASFSCACAPGYTGTRCESQVDECRSQPCRHGGKCLDL
VDKYLCRCPPGTTGVNCEVNIDDCASNPCTFGVCRDGINRYDCVCQPGFTGPLCNVEINE
CASSPCGDGGSCVDGENGFRCLCPPGSLPPLCLPTSHPCAQEPCSHGVCHDAPGGFRCMC
EPGWSGPRCSQSLARDACESQPCRSGGTCTSDGIGFHCTCPPGVQGRQCELPSPCTPNPC
EHGGHCESAPGQLPVCSCPPGWQGPRCQQDVDECAGPSPCGSHGTCTNLAGSFSCTCHEG
YSGPSCDQDIDDCDPNPCLNGGSCQDGVGSFSCSCLPGFAGPRCARDVDECLSSPCGPGT
CADHVASFTCTCPPGYGGFRCEQDLPDCSPSSCFHGGTCVDGVNSFSCQCRPGFTGAHCQ
HEADPCVSRPCLHGGVCTAARPGFRCTCPEGFTGAQCQTLVDWCSHAPCQNGGRCARSGA
SFYCLCPPGWSGRVCDIRSVPCREAAAQIGVRLEELCQTGGQCVDKDNSHYCVCPEGRTG
SHCEQEVDPCLAQPCQHGGTCRGYMGGYVCECPAGYTGDDCEDDVDECASQPCQNGGFCI
DLVARYLCSCPPGTLGVLCEINEDDCGPGPPLDQGPRCLHNGTCVDLVGGFRCTCPPGYT
GLRCEADINECHPGACHDAHTRDCLQDPGGGFRCLCHGGFTGPRCQTVLSPCESQPCQHG
GQCRPSPGPGGALTFTCRCVPPFWGPRCERVARTCRELQCPAGVPCQQTVRGPRCACPPG
LSGPACRGSRGSPPGAANASCLASPCLHGGSCGPAPLAPFFRCACAPGWDGPRCEVPAAA
PEAPEEPLCPSAACEAKSGDKRCDRECNSPGCGWDGGDCSLSVGDPWRQCAALQCWRLFN
NSRCDPACSSPACLYDNFDCRAGGRERACNPVYEKYCADHFADGRCDQGCNTEECGWDGL
DCAGEVPALLARGVLVLTVLLPPEELLRSSADFLQRLSGILRTSLRFRLDEHGQAMVFPY
HRPGPGAESRNRRELAPEVIGSVVMLEIDNRLCLQSPENDHCFPDAQSAADYLGALSAVE
RLDFPYPLRAVRGEPLELPEPSMPLLPLLAASAVFLLAILVLGVMVARRKREHSTLWFPE
GFALHKDVAAGHKGRREPVGQDALGMKNMAKSESLMGQVATDWMDTECPEVKRLKVEDPG
VGAEDAVDCRQWTQHHLVAADIRVAPAMALTPPQGDVDADGVDVNVRGPDGFTPLMLASF
CGGALEPMPTEEDEAEDASASIISDLICQGAQLGARTDRTGETALHLAARYARADAAKRL
LDAGADTNAQDHSGRTPLHTAVTADAQGVFQILIRNRSTDLDARMADGSTALILAARLAV
EGMVEELIASHADVNAVDELGKSALHWAAAVNNVEATLALLKNGANKDMQDSKEETPLFL
AAREGSYEAAKLLLDHFANREITDHLDRLPRDVAQERLHQDIVRLLDQPSGPRSPPGPHG
LGPLLCPPGAFLPGLKVAQSGGKKSRRPPGKAGLGPQGARGRGKKLTLACPGPLAESSVT
LSPVDSLDSPRPFGGPPASPGGFSLEGPYAAATATAVSLAQLGGAGRAGLGRQPPGGCVL
SLGLLNPVAVPLDWARLPPPAPPGPSFLLPLAPGPQLLNPGTPVSPQERPPPYLAAPGHG
EEYPAAGAHGSPPKARFLRVPSEHPYLTPSPESPEHWASPSPPSLSDWSDSTPSPATATG
PAATAAGALPAQPLPLSVPGPLAQAQTQLGPQPEVTPKRQVLA
NT seq 6972 nt NT seq  +upstreamnt  +downstreamnt
atggggccggggacccggggccgccgccgccgccgtcgcccgatgtcggcgccgccaccg
ctgccgcccgtgcgggcgctgcccctgttgctactgctcgcggggcccggggctgcagcc
cccccttgcctggacggaagcccgtgtatgaatggaggtcgctgcacccagctgccctcc
cgggaggctgcctgcctgtgccctccaggatgggtgggcgagcggtgccagctggaggac
ccctgccattcgggcccctgtgctggccgtggtgtctgccagagctcggtggtggcaggc
actgcccggttctcctgccgctgcccccgtggcttccggggtcctgactgctccctgccg
gacccctgcctcagcagcccctgtgcccatggtgcccgctgctccgtggggcccgatggc
cgctacctctgctcctgcccgcctggctaccagggccgcagctgccgaagcgatgtggat
gagtgccgggtgggagggccgtgccgccacggtggcacctgcctcaacacgcctggttcc
ttccgctgccagtgcccagctggctacacggggccactgtgtgagaacgctgcagtgccc
tgcgctccctcgccgtgccgaaacgggggcacgtgtagacagagtggcgacctcacctac
gactgtgcctgccttcctgggttcgagggccagaactgtgaagtgaatgtggatgactgt
ccagggcaccgctgtctaaatgggggcacgtgtgtggatggcgtcaacacctacaactgc
cagtgccctcctgagtggacaggccaattctgcacggaggacgtggatgaatgccagctg
cagcccaatgcttgccacaacgggggcacctgtttcaacacactgggtggccacagctgt
gtgtgtgtcaacggctggacaggcgagagctgcagtcagaatatcgatgactgtgccacg
gccgtgtgcttccatggggccacctgccatgaccgcgtggcctcgttctactgtgcctgc
cccatgggcaagactgggcttctctgtcatctggatgacgcctgtgtcagcaacccctgt
cacgaggatgctatctgtgacacgaacccggtgaacggacgggccatctgcacctgtcca
ccaggcttcaccggcggggcatgtgaccaggatgtggatgagtgctccattggcgccaac
ccgtgtgagcacctgggccggtgtgtgaacacacagggctcattcctgtgccagtgtggc
cgtgggtacacaggcccgcgctgcgagaccgacgtcaacgagtgcctatcggggccctgc
cgcaaccaggccacgtgcctcgaccgcataggccagttcacctgcatctgcatggcaggc
tttacaggcacctattgtgaggtggacgtggatgagtgtcagagcagcccgtgtgttaat
ggcggggtctgcaaggacagagtcaacggcttcagctgcacctgcccctcgggcttcagc
ggggccatgtgtcaactggatgtggatgagtgcgccagcacaccttgccggaatggagcc
aaatgtgtggaccagcccgatggctacgaatgtcgctgcgcagagggtttcgaaggcact
ctgtgtgagcgcaacgtggatgactgttccccggacccgtgccaccacgggcgctgtgtg
gatggcatcgccagcttctcctgcgcttgtgccccgggatacacaggcacacgctgtgag
agccaggtggacgagtgccgcagccagccctgccgccacggaggcaaatgtctagacttg
gtggacaagtatctctgccgctgccctcctggcaccacaggagtgaactgcgaggtgaac
attgatgattgtgccagcaacccctgcacctttggagtgtgccgggatggcatcaaccgc
tatgactgtgtctgccagcctggcttcacagggcccctttgcaacgtggagatcaacgag
tgtgcgtccagcccgtgcggtgatggaggctcctgtgtggatggggaaaatggcttccgc
tgcctctgcccacctggctccctgcccccgctctgccttcccacgagccatccctgtgcc
caagaaccctgcagtcacggtgtctgccacgatgcgcccggagggttccgctgcatgtgt
gagcctgggtggagtggcccccgatgcagccagagccttgctcgagatgcctgtgaatcc
cagccctgccggtctggtggcacctgcaccagtgatggaatcggcttccactgtacctgt
ccccctggtgtccagggccgtcagtgtgagctgccatcgccctgtactccaaacccttgt
gagcatgggggtcactgtgagtctgcccctggccagctgcctgtctgctcctgtcctcct
ggctggcaaggcccacgatgccagcaggatgtggatgaatgtgctggcccctcaccctgt
ggctcccacggtacctgcaccaacctggcggggagtttcagctgtacctgccacgagggg
tatagtggcccttcctgtgatcaggacatcgatgactgtgaccccaacccctgcctgaat
ggtggctcctgccaggatggcgtgggctccttttcatgctcctgcctccctggctttgct
ggtccccgctgtgcccgcgacgtggatgagtgtctgagcagcccctgtggccccggcacc
tgcgccgaccacgtggcctcctttacctgcacgtgcccacctggatatggaggcttccgc
tgtgagcaggacctacccgactgcagccccagctcctgcttccacggcgggacctgtgtg
gacggcgtgaactcgttcagctgccagtgccgcccgggcttcacgggcgcacactgccaa
cacgaggccgacccctgcgtctctcggccctgcctgcacgggggcgtctgcacggccgcc
cgccctggcttccgctgcacctgtccggagggcttcactggcgctcagtgccagacgctg
gtagactggtgcagccacgcgccctgtcagaacgggggtcgctgtgcccggagcggggcc
tccttctactgcctttgccctccgggttggagcggccgcgtctgtgacatccggagtgtg
ccctgcagggaggccgcagcccagatcggggtgcggctggaagagctgtgtcagactggt
gggcagtgcgtggacaaggacaattcccactattgcgtgtgtccagaaggccgcacgggc
agccactgtgagcaggaggtggacccctgcttggcccagccctgccagcatgggggcacc
tgccgcggctacatggggggttatgtgtgcgagtgtccagctggctacaccggggacgac
tgtgaggatgatgtggacgagtgcgcctcccagccctgccagaacgggggcttctgcatt
gacctcgtggcccgctatctctgctcctgccccccgggaacgctgggtgtgctctgtgag
attaatgaggacgactgtggcccaggcccacccctggaccagggcccccggtgcctgcac
aatggtacctgtgtggacctcgtgggtggctttcgctgcacctgcccccccgggtacact
ggcctgcgctgcgaggcggacatcaatgagtgtcacccgggtgcctgccacgatgcacac
acccgggactgtctgcaggacccaggtgggggcttccgctgcctttgtcatgggggcttc
acaggtccccgctgtcagactgtcctgtctccctgtgagtcccagccatgccagcacgga
ggccagtgccgtcccagcccaggacctgggggtgcgctgacatttacctgccgctgcgtt
ccgccgttctggggcccgcgttgcgagcgggtggcgcgcacctgccgggagctgcagtgc
ccggcgggcgtcccgtgccagcagacggtccgtgggccgcgctgcgcctgccccccggga
ctgtcggggcccgcctgccggggctcgcgggggtcgccgccgggggccgccaacgccagc
tgcctggcctccccctgcctccacggcggctcctgcggccccgcgcccctcgcacctttc
ttccgctgcgcgtgcgcgccaggctgggacggaccgcgctgcgaggtgcccgcggcggcg
cccgaggcccccgaggagccgctgtgcccgagcgccgcctgcgaggccaagagcggggac
aagcgctgcgaccgcgagtgcaacagcccgggctgcggctgggacggcggcgactgctcg
ctgagcgtgggcgacccctggcggcagtgcgcggcgctgcagtgctggcgcctcttcaac
aacagccgctgcgaccccgcctgcagctcgcccgcctgcctctatgacaacttcgactgc
cgcgcgggcggccgggagcgcgcctgcaaccccgtgtacgagaagtactgtgcggaccac
tttgcggacggccgctgcgaccagggctgcaacacggaggagtgcggctgggacgggctg
gactgcgcgggcgaggtgcccgccctgctggcccgcggcgtgctggtgctcaccgtgctg
ctcccgcccgaggagctgctgcgctccagcgccgacttcctgcagcggctgagcggcatc
ttgcgcacgtcgctgcgcttccgcctggacgaacacggtcaggccatggtcttcccgtac
caccggcccggccctggcgccgaatcccggaaccggcgggagctggccccggaggtgatc
ggctctgtggtgatgctggagattgacaaccggctgtgcctgcagtcaccggagaatgac
cactgctttcccgacgcccagagtgcggccgactacctgggagccttgtcggcggtggaa
cgccttgacttcccgtacccgctgcgggccgtgcgaggggagccgctggagctgccggag
ccgagcatgccgctgcttccgctgctggccgccagcgcggtcttcctgctggccatcctc
gtgctgggcgtcatggtggcccggcgcaagcgtgagcacagcaccctctggttccccgag
ggcttcgcgctccacaaggatgtggctgccggccacaagggccgccgggagcccgtgggc
caagacgcgctgggcatgaagaacatggccaagagcgagagtctgatggggcaggtggcc
acagactggatggacactgagtgcccagaagtgaagcgacttaaggtagaggaccctggc
gtgggggccgaggatgctgtggattgccgccagtggactcaacaccacctggttgcagct
gacatccgtgtggcaccagccatggccttgacgcccccacagggcgatgtggatgctgat
ggcgtggatgtcaatgtgcgtggcccagacggcttcaccccactgatgctggcctctttc
tgtggcggggctctggagccaatgcccaccgaggaggatgaggcagaagacgcgtcagcc
agcatcatctcagacctgatctgccagggagcccagcttggggcacggactgaccgcacg
ggcgagacagccctgcacctcgctgcccgctatgcccgggccgatgcggccaagcggctg
ctggatgccggggcagacaccaatgcccaggaccattcaggccgcactcctttgcacact
gctgtcaccgctgatgcccaaggcgtcttccagattctcatccggaaccgctccacagac
ctggatgcccgcatggcggatggttcaacggcgctaatccttgcagcccgtctggcggtg
gagggcatggtggaagaactcattgccagccacgctgatgtcaatgctgtggatgagctt
gggaaatcagccttacactgggcagcagccgtcaacaatgtggaggccacgttggccctg
ctcaaaaatggagccaacaaggacatgcaggatagcaaggaggaaactccactgtttctg
gccgcccgggagggcagctatgaggctgccaagctgctgctggaccacttcgccaaccgc
gagatcacagaccacctggacaggctgccgcgggacgtggcccaggagcggctgcaccag
gacatcgtgcgcctgctggaccagcccagtgggccccggagccctcccggcccacacggc
ctggggcccctcctctgcccaccgggggccttcctcccgggcctcaaggtggcacagtct
gggggcaagaagagccggaggccacccgggaaggcggggctggggccgcagggcgcccgg
gggcggggcaagaagctgacgctggcctgccccggtcccctggccgagagctcggtcacg
ctgtcgcccgtggactcgctggactccccgaggcccttcggtgggccccccgcgtcccct
ggcggcttctccctcgaggggccctacgcggctgccaccgccacggctgtgtccctggcg
cagctcggtggcgccggccgggccggtctagggcgccagccccctgggggctgcgtgctc
agcttgggtctgctgaaccccgtggccgttcccctcgactgggcccggctgccgccacct
gccccgccgggcccctcgttcctgctgccactggcgccgggaccccagctgctgaacccc
gggacccccgtgtcgccccaggagcggcccccaccgtacctggcggccccgggacacggc
gaggagtacccggcagccggcgcccacggcagcccccccaaggcccgcttcctgagggtc
cccagcgagcacccttacctgaccccctcccccgagtcccccgagcactgggccagcccc
tcgcctccctccctctcagactggtcggactccacgcccagcccagccactgccaccggg
cccgcggccacagccgctggggcgctgcctgcccagccgctccccctttccgtcccaggc
ccgctagctcaggcccagacccagctggggccccagcccgaagtcacccccaagaggcag
gtgttggcctga

KEGG   Felis catus (domestic cat): 101091800Help
Entry
101091800         CDS       T02385                                 

Gene name
NOTCH2
Definition
(RefSeq) neurogenic locus notch homolog protein 2 isoform X1
  KO
K20994  Notch 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101091800 (NOTCH2)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101091800 (NOTCH2)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101091800 (NOTCH2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101091800 (NOTCH2)
   05206 MicroRNAs in cancer
    101091800 (NOTCH2)
  09162 Cancer: specific types
   05224 Breast cancer
    101091800 (NOTCH2)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101091800 (NOTCH2)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101091800 (NOTCH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA DUF3454 EGF_2 Notch NOD Ank_2 Ank Ank_5 NODP Ank_3 Ank_4 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 101091800
NCBI-ProteinID: XP_011283396
Ensembl: ENSFCAG00000009649
UniProt: A0A2I2U0T9
Position
C1
AA seq 2471 aa AA seqDB search
MPALLPAPLWALLALWLCRAAPARALQCRDSYEPCVNEGICVTYHNGTGYCKCLEGFLGE
YCQHRDPCEKNRCQNGGTCVAQAMLGKATCRCALGFTGDDCQYSTAHPCFVSHPCLNGGT
CHVRSRDDYECTCQVGFTGKLCQWTDACLSHPCANGSTCTTVANQFSCRCLAGFTGQKCE
TDVNECDIPGQCQHGGTCLNLLGSYQCQCPQGFTGQHCDSPYVPCAPSPCVNGGTCRQTG
DFTFECNCLPGFEGITCERNIDDCPNHKCQNGGVCVDGVNTYNCRCPPQWTGQFCTEDVD
ECLLQPNACQNGGTCTNRNGGYGCVCVNGWSGDDCSENIDDCAFASCTPGSTCIDRVASF
SCMCPEGKAGLLCHLDDACISNPCHKGALCDTNPLNGQYICTCPQGYKGADCTEDVDECA
MANSNPCEHAGKCVNTDGAFHCECLRGYTGPRCELDINECHSDPCQNDATCLDKIGGFTC
LCMPGFKGVHCELEINECQSNPCVNNGQCVDKVNRFQCLCPPGFTGPVCQIDIDDCSSTP
CLNGAKCIDHPNGYECQCATGFTGVLCEENIDNCDPDPCHHGQCQDGIDSYTCICNPGYM
GAICSDQIDECYSSPCLNDGRCIDLVNGYQCNCQPGTSGVNCEINFDDCASNPCVHGVCM
DGINRYSCVCSPGFTGQRCNIDIDECASNPCRKGATCINDVNGFRCLCPEGPHHPSCYSQ
VNECLSSPCIHGNCTGGLSGYKCLCDAGWVGINCEVDKNECLSNPCQNGGTCDNLVNGYR
CTCKKGFKGYNCQVNIDECASNPCLNQGTCFDDISGYTCHCVLPYTGKNCQTVLAPCSPN
PCENAAVCKEAPNFESYTCLCAPGWQGQRCTIDIDECVSKPCMNHGLCHNTQGSYMCECP
PGFSGMDCEEDIDDCLANPCQNGGSCVDGVNTFSCLCHPGFIGDKCQTDMNECLSEPCKN
GGTCSDYVNSYTCKCQAGFDGVHCENNIDECTESSCFNGGTCVDGINSFSCLCPVGFTGP
FCLHEINECNSHPCLNEGVCVDGLGTYRCTCPLGYTGKNCQTLVNLCSRSPCKNKGTCVQ
EKAESRCLCPSGWAGAYCDVPNVSCEVAAFHRGVSIDHLCQHSGICINAGNSHHCQCPLG
YTGSYCEEQLDECSSNPCQHGATCRDFIGGYRCECVPGYQGVNCEYEVDECQNQPCQNGG
TCVDLVNHFKCSCPPGTRGLLCEENIDDCAGGPHCLNGGQCVDRIGGYSCRCLPGFAGER
CEGDINECLSNPCSSEGSLDCIQLTNDYLCVCRSAFTGRHCETFVDVCPHMPCLNGGTCA
VASNMPDGFICRCPPGFSGARCQSSCGQVKCRRGEQCVHTASGPRCFCPNPQDCESGCAS
SPCQHGGSCYPQRQPPYYFCQCSPPFWGSHCELYTAPTSTPPATCLSQYCADKARDGVCD
EACNSHACQWDGGDCSLTMENPWANCSSPLPCWDYINNQCDELCNTAECLFDNFECQGNS
KTCKYDKYCADHFKDNHCDQGCNSEECGWDGLDCAADRPENLAEGTLVIVVLMPPEQLLQ
DARSFLRALGTLLRTNLQIKRDSQGVLMVYPYYGEKSAAMKKQRMIRRSLPGDQEQEVVG
SKVFLEIDNRQCVQDSDQCFKNTDAAAALLASHAIQGTLSYPLVSVVSESLTRKGTQLLY
LLAVAVVIILFIILLGVIMAKRKRKHGSLWLPEGFTLRRDSSNHKRREPVGQDAVGLKNL
SVQVSEANLIGSGTSEHWVDDEGPQPKKAKAEDEALLSEEDDAIDRRPWTQQHLEAADIR
RTPSLALTPPQAEQEVDVLDVNVRGPDGCTPLMLASLRGGSSDMSDEDEDGEDSSANIIT
DLVYQGASLQAQTDRTGEMALHLAARYSRADAAKRLLDAGADANAQDNMGRCPLHAAVAA
DAQGVFQILIRNRVTDLDARMNDGTTPLILAARLAVEGMVAELINCQADVNAVDDHGKSA
LHWAAAVNNVEATLLLLKNGANRDMQDNKEETPLFLAAREGSYEAAKILLDHFANRDITD
HMDRLPRDVARDRMHHDIVRLLDEYNVTPSPPGTVLTSALSPVICGPNRSFLSLKHTPMG
KKPRRPNTKSAMPTSLPNLAKEAKDAKGSRRKKSLSDKGQLSESSVTLSPVDSLESPHTY
VSDTTSSPMITSPGILQASPNPMLATAAPPAPVHAQHALSFSNLHEMQPLAHGANTVLPS
VSQLLSHHHIVPPGSGSTGSLGRLHPVTVPADWMNRMEMNETQYNEMFSMVLAPAEGTHP
GIAPQSRPPEGKHITTPREPLPPIVTFQLIPKGSISQPAGTPQPQSNCPPPVAGPVPTMY
QIPEMARLPNMAFPTAMMPQQDGQVAQTILPAYHPFPASVGKYPTPPSQHSYASSNAAER
TPSHSGHLQGEHPYLTPSPESPDQWSSSSPHSASDWSDVTTSPTPGGAGGGQRGPGTHMS
EPPRSNMQVYA
NT seq 7416 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccctgctccccgctcccctgtgggcgctgctggcgctctggttgtgccgcgcg
gcccccgcgcgtgcattgcagtgtcgggacagctatgagccctgtgtaaatgaaggaata
tgtgttacctaccacaatggtacaggatactgcaaatgtctggagggcttcttgggagaa
tattgtcaacatcgagacccctgtgagaagaaccgctgccagaatggggggacgtgtgtg
gcccaggccatgttggggaaagccacatgccgatgtgccctggggttcacaggtgatgac
tgtcagtactcaactgctcacccctgctttgtgtctcacccctgcctgaatggaggcacc
tgccatgtgcgtagccgggacgactatgagtgtacctgccaagttggttttacaggtaag
ctgtgccaatggaccgatgcctgcctatctcatccctgtgcaaatggaagtacctgcacc
actgtagccaaccagttctcctgcagatgcctcgcaggcttcacaggacagaagtgtgag
actgacgtcaatgagtgtgacatcccaggacagtgtcagcatggtggcacctgcctcaat
ctactgggttcctatcagtgccagtgcccccagggcttcacaggccagcactgtgacagc
ccctatgtgccctgtgcaccctccccctgtgtcaatggaggcacctgccggcagactggt
gacttcacatttgaatgcaactgccttccaggttttgaagggatcacctgtgagcggaat
attgatgactgccctaaccacaagtgtcagaatggaggagtttgtgtggatggggttaat
acttacaactgccgctgcccccctcagtggacaggacagttctgcacagaggatgtagac
gagtgtctgctgcaacctaacgcttgtcagaacggaggcacctgcaccaaccgcaacggg
ggctatggctgcgtgtgtgtcaatggctggagtggagacgactgcagtgagaacatcgat
gactgcgccttcgcctcctgcactcccggctccacgtgcattgaccgtgtggcctccttc
tcttgcatgtgccctgaaggaaaggcaggtctcttgtgtcatttggatgatgcatgcatc
agcaatccttgccataagggggcactgtgtgataccaaccccctgaacgggcagtatatt
tgcacctgcccccaaggctacaaaggcgctgactgcacagaagatgtggatgaatgtgcc
atggccaatagcaatccttgtgagcatgcaggaaaatgtgtgaatacagatggtgccttc
cactgtgaatgtctgaggggctatacagggcctcgttgcgagttggatatcaatgagtgc
cattccgacccctgccagaacgatgcgacctgtctggataagattggaggcttcacgtgt
ctgtgcatgccaggtttcaaaggtgtgcattgtgaattggagataaacgaatgtcagagc
aacccttgtgtgaacaatggtcagtgtgtagataaagtcaatcgcttccagtgtctgtgt
ccgcctggtttcactgggccagtttgccagattgatattgatgactgttccagtactccg
tgtctgaatggggcaaagtgtattgatcacccaaatggctatgaatgccagtgtgccaca
ggattcactggtgtgttgtgcgaggagaacatcgacaactgtgaccctgatccttgccac
catggccagtgtcaggatgggattgattcctacacctgcatctgcaacccggggtacatg
ggtgccatctgcagtgaccagatagatgaatgttacagcagcccttgcctgaatgatggt
cgctgcattgaccttgtaaatggctaccagtgcaactgccagccaggcacgtcaggtgtt
aattgtgaaatcaattttgatgactgtgcaagtaacccttgtgtccacggagtctgtatg
gatggcattaatcgttatagttgtgtctgctcaccgggattcacagggcagagatgtaac
atcgacattgatgagtgtgcctccaatccctgtcgcaagggtgcgacgtgcatcaacgac
gtgaatggtttccgctgtctatgccctgagggaccccatcaccccagctgctactcacag
gtgaacgagtgcctgagcagtccctgcatccatgggaactgtaccggaggcctcagcgga
tacaagtgtctctgtgatgcaggctgggttggcatcaactgtgaagtggacaaaaatgaa
tgtctttctaacccgtgccagaatggaggaacatgtgacaatctggtgaacggatacagg
tgtacttgcaagaagggctttaaaggctataactgtcaggtgaatattgatgaatgtgct
tcaaatccctgcctgaaccaaggaacctgctttgatgacataagtggctacacttgccac
tgtgtgctgccatacacaggcaagaattgtcagactgtgttggctccctgttccccaaac
ccatgtgagaatgctgctgtttgcaaagaggcaccaaattttgagagctacacctgcctg
tgtgcccctggctggcaaggtcagcggtgtacaattgacattgatgagtgtgtctccaag
ccttgcatgaaccacggtctctgccataacacccagggcagctacatgtgtgagtgtcct
ccaggcttcagcggtatggactgtgaggaggacatcgatgactgccttgccaatccttgc
cagaatggaggttcctgtgtagatggagtgaatactttctcctgtctgtgccaccctggc
tttattggggacaagtgtcagacagacatgaatgagtgtctgagtgaaccgtgtaagaat
ggagggacctgctccgactatgtcaacagttacacttgcaagtgccaggcgggatttgat
ggagtccactgtgagaacaacatcgatgagtgcactgagagctcctgtttcaatggtggc
acgtgtgtcgacgggattaactccttctcttgcttgtgtcctgtgggcttcactggcccc
ttctgcctccatgagatcaatgaatgcaactctcatccatgcctaaatgaaggagtatgt
gttgatggcctaggtacctaccgctgcacctgccccttgggctacactggcaaaaactgt
cagaccctagtgaacctctgtagtcggtctccatgtaaaaacaaaggtacttgcgttcag
gaaaaagcagagtcccggtgtctgtgtccatctggatgggctggtgcttactgtgatgtg
cccaatgtatcctgtgaggtggcggctttccacagaggagtgtccattgaccacctgtgc
cagcactctggcatctgcatcaatgctggaaactcgcatcactgccagtgccccctgggc
tacaccgggagctactgtgaggagcagctcgatgagtgctcgtccaacccctgccagcat
ggagccacttgcagggacttcatcggcgggtatagatgtgagtgtgtcccaggatatcag
ggtgtcaattgtgagtatgaagtggacgagtgccagaatcagccatgccagaacggaggc
acctgtgtcgaccttgtgaaccatttcaagtgctcctgtccaccaggcactcgaggcctg
ctctgcgaagagaacattgacgactgtgccggcggtccccactgccttaacggtggtcag
tgtgtggataggattgggggctacagttgccgctgcttgcccggctttgcaggagaacgg
tgtgagggggacatcaacgagtgcctctccaacccctgcagctctgagggcagcctggac
tgcatacagctgaccaacgactacctgtgtgtctgccgcagtgccttcactggtcgtcac
tgtgaaactttcgtcgatgtgtgtccgcatatgccttgcctgaatggggggacttgtgct
gtggccagcaacatgcccgatggtttcatttgtcgttgtcccccgggattctccggggca
agatgccagagcagctgtggacaagtgaagtgcaggagaggggagcagtgtgtgcacacg
gcctcaggaccccgctgcttctgccccaacccccaggactgcgagtcaggctgtgccagt
agcccctgccagcatgggggtagctgctaccctcaacgccagcctccttattacttctgc
cagtgttctccaccattctggggcagccactgtgagctttacacggcccccaccagcacc
cctcctgccacctgtctgagccagtattgtgccgacaaagctcgggacggcgtctgcgat
gaggcatgcaacagccatgcctgccagtgggatgggggtgactgttccctgaccatggag
aacccctgggccaactgctcttccccacttccctgctgggattacatcaacaaccagtgt
gatgagctgtgtaacacggccgagtgcctttttgacaactttgaatgccaagggaacagc
aagacgtgcaagtatgacaaatactgtgcagaccacttcaaagacaaccactgtgaccag
ggatgcaacagtgaggagtgtggctgggatgggttggactgtgctgctgaccggccggag
aacctggcggaggggaccctggttatagtggtgctcatgcccccagagcagcttctccag
gatgcccgcagctttttgcgggcactgggcaccctgctccgtaccaacctgcagattaaa
cgggactcccagggggtactcatggtctacccctattatggtgagaagtcggctgccatg
aagaagcagaggatgatacgcaggtcccttcctggtgaccaagaacaggaggtggttggc
tctaaggtgtttctggaaattgacaaccgccagtgtgttcaagattcagaccagtgtttc
aagaacacggatgcagcagcagctcttctggcctctcacgccatccaggggaccttgtcc
taccctcttgtgtccgtcgtcagtgaatctctgactcgaaaaggtactcagcttctctat
ctacttgctgttgccgttgtcattatcctgtttattatcttgctgggagttatcatggcg
aaacgaaagcgtaagcatggctccctctggctgcctgaaggtttcacccttcgccgagac
tccagcaatcacaagcgccgtgagccagtgggacaggatgccgtggggctgaaaaatctc
tcagtgcaagtctcagaggctaacctaattggttctggaacaagtgaacattgggttgat
gatgaagggccccagccaaagaaagccaaggctgaagatgaggctttgctctcagaagaa
gatgatgccattgatcgacgtccatggacacagcagcaccttgaggctgcagatatccgc
aggacgccatcgctggcactcactcctccacaggcagagcaggaggtggatgtgttggat
gtgaatgtccgtggcccagatgggtgcaccccactgatgctggcttccctccgaggaggc
agctcagatatgagtgatgaagatgaagatggagaggactcttctgccaacatcatcaca
gacttggtctaccagggtgccagcctgcaggcccagacagaccggactggtgagatggct
ctgcaccttgcagcgcgctactcaagggctgatgccgccaagcgtctcctggatgcaggt
gcagacgccaacgcccaggacaacatgggccgctgccctctccatgctgcagtggcagct
gatgcccagggggtcttccagattctgatccgcaaccgagtaactgatctggacgccagg
atgaacgatggcactacaccactgatcctggccgcccgcctggctgtggagggaatggtg
gcagaactgatcaactgccaagcagatgtgaatgcagtagatgaccatggaaaatccgct
cttcactgggcagctgctgtcaataacgtggaggcaacccttttgctgttgaaaaacggg
gccaaccgagacatgcaagacaacaaggaagagacacctctgtttcttgctgcccgggag
ggaagctatgaagcagccaagatcctgttagaccattttgccaatcgggatatcacagac
cacatggatcgtcttccccgggatgtggctcgggaccgcatgcaccatgacatcgtgcgc
ctcctagacgagtacaatgtgacaccgagccctccaggcactgtgctgacttctgccctc
tcacctgtcatctgtgggcccaacagatctttcctcagcctaaagcacaccccaatgggc
aagaagcctagacggcccaataccaagagtgccatgcccactagcctccctaaccttgcc
aaggaggccaaggatgccaagggtagtaggaggaagaagtctctgagtgacaagggtcag
ctgtctgagagttcagtgactttatccccagttgattccttagagtctcctcacacatat
gtttctgacaccacatcctctccaatgattacatcccctggaatcttacaggcctcaccc
aaccctatgttggccactgctgcaccccctgccccagtccatgcacagcatgcactgtcc
ttctctaacctgcatgaaatgcagcctttggctcacggggccaacactgtgcttccctca
gtgagccagctgctatcccaccaccacattgttcccccaggcagtggtagtacggggagc
ttgggcaggctccatccagtcactgttccagcagattggatgaaccgcatggagatgaat
gagacccagtacaatgagatgtttagtatggttctggctccagctgagggcacgcaccct
ggcatagctccccagagcagaccacctgaagggaagcatataactacccctcgggagccc
ttgccccccattgtgactttccagctaatccccaaaggcagtatttcccaaccagcaggg
actccccagcctcagtccaactgccccccacctgttgcaggccctgtgcccaccatgtac
cagattccagaaatggctcgtttgcctaatatggcttttcccactgccatgatgccccag
caggatgggcaggttgctcagaccattctcccagcctatcatcctttcccagcctctgtg
ggcaagtatcccacaccaccttcacagcatagttatgcttcctcaaatgctgctgagcga
acacccagtcacagtggtcacctccagggtgagcatccctacctgacaccatccccagag
tctcctgaccagtggtcaagttcatcaccccactctgcttctgactggtcagatgtgacc
accagccctacccctgggggtgctggaggaggtcagcggggacctggaacacacatgtct
gagccaccgcgcagcaacatgcaggtgtatgcatga

KEGG   Felis catus (domestic cat): 101094384Help
Entry
101094384         CDS       T02385                                 

Gene name
NOTCH1
Definition
(RefSeq) neurogenic locus notch homolog protein 1
  KO
K02599  Notch 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca05020  Prion diseases
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101094384 (NOTCH1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101094384 (NOTCH1)
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    101094384 (NOTCH1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101094384 (NOTCH1)
   05206 MicroRNAs in cancer
    101094384 (NOTCH1)
  09162 Cancer: specific types
   05224 Breast cancer
    101094384 (NOTCH1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    101094384 (NOTCH1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101094384 (NOTCH1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101094384 (NOTCH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA EGF_2 Ank_2 Notch Ank DUF3454 NOD NODP Ank_5 Ank_4 Ank_3 EGF_3 cEGF
Motif
Other DBs
NCBI-GeneID: 101094384
NCBI-ProteinID: XP_023098769
Ensembl: ENSFCAG00000023517
Position
D4
AA seq 2543 aa AA seqDB search
MPPLLAPLLCLALLPALAARGLRCSQPSESCMNGGNCEVSPNGTEACVCSGAFAGRRCQA
PNPCLSAPCKNAGTCHAVDHGGTVDYACACRLGFSGPLCLTPRDNACLAKPCRNGGTCDL
LTLTEYKCRCPPGWSGKMCQQADPCASNPCANGGQCLPFEASYICRCPPGFHGPTCRQDV
NECGQSPGLCRNGGTCHNEVGSYRCTCRATHTGPHCELPYVPCSPSPCQNGGTCRPTGDT
THECACLPGFTGQNCEENIDDCPGNSCKNGGTCVDGVNTYNCRCPPEWTGQYCTEDVDEC
QLMPNACQNGGTCHNTHGGYNCVCVNGWTGEDCSENIDDCASAACFHGATCHDRVASFYC
ECPHGRTGLLCHLNDACISNPCNEGSNCDTNPVNGKAICTCPSGYTGPACSQDVDECSLG
ANPCEHAGKCINTLGSFECQCLQGYTGPRCEIDVNECISNPCQNDATCLDQIGEFQCICM
PGYEGVHCEVNTDECASSPCLQNGRCLDKINEFLCECPTGFTGHLCQYDVDECASTPCRN
GAKCLDGPNTYTCVCTEGYTGPHCEVDIDECDPDPCHYGSCKDGVATFTCLCRPGYTGHH
CETNVNECHSQPCRHGGTCQDRDNAYLCLCLKGTTGPNCETNLDDCASSPCDSGTCLDKI
DGYECSCEPGYTGSMCNVNIDECAGNPCHHGGTCEDGTNSFTCRCPEGYHGPTCLSEVNE
CSSNPCIHGACRDSLNGYTCDCDPGWSGAHCDINTNECESNPCANGGACRDMTSGYVCTC
REGFSGPNCQTNINECASNPCLNQGSCIDDVAGYTCNCPLPYTGATCEVVLAPCAPGPCR
NGGECRESEDFESFSCVCPAGWQGQTCEVDINECVKNPCRHGASCQNTNGGYRCRCRAGY
TGHNCETDVDDCRPNPCHNGGSCTDGVNTAFCDCLPGFRGAFCEEDINECASNPCHHGAN
CTDCVDSYTCTCPTGFSGIHCENNTPDCTESSCFNGGTCVDGISSFTCLCPPGFTGSYCQ
HDVNECDSRPCLHGGTCQDSYGTYKCTCPQGYTGLNCQNLVRWCDSSPCKNGGKCWQTNT
LYRCECHSGWTGLYCDVPNVSCEVAARRRDINVTHLCRNGGLCMDAGNTHHCRCQAGYTG
SYCEDQVDECSPSPCQNGATCTDYPGGYSCECVAGYHGVNCSEEINECLSHPCQNGGTCI
DLINTYKCSCPRGTQGVHCEVNVDDCSPLIDPVSRGPKCFNNGTCVDQVGGYSCTCPPGF
VGERCEGDVNECLSNPCDARGTQNCVQRVNDFYCECRAGHTGRRCESVINGCKGRPCQNG
GTCAVASNTARGFICKCPAGFEGATCENDARACGSLRCLNGGTCISGPRSPTCLCLGPFT
GPECQFPAGSPCVGGNPCYNQGSCEPVPESPFYRCLCPAKFNGLLCHILDYSFGGGLGVD
ISPPQIEEACELPECREEAGNKVCSLGCNNHACGWDGGDCSLNFNDPWQNCSQSLQCWKY
FSDGRCDSQCNSAGCLFDGFDCQRADGQCNPLYDQYCKDHFGDGHCDQGCNSAECEWDGL
DCAEHVPERLAAGALVLVVLTPPAQLRNNSLHFLRELSRLLHTNVVFKRDAHGQPMVFPY
YGREEELRKHPIKRAVDGWAAPGALLDRVEAALLPGGGAGRRRRELDPMDIRGSIVYLEI
DNRQCVQSSSQCFQSATDVAAFLGALASLGSLNIPYKIEAVQSETVEPPPPPQLHFMYVA
VAAFVLLFFVGCGVLLSRKRRRQHGQLWFPEGFKVSEASKKKRREPLGEDSVGLKPLKNA
SDGALMDDSQHEWGDEDLEAKKFRFEEPVVLPDLDDQADHRQWTQQHLDAADLRVSAMAP
TPPQGEADADSMDVNVRGPDGFTPLMIASCSGGGLETGNSEEEEDAPAVISDFIYQGASL
HNQTDRTGETALHLAARYSRSDAAKRLLEASADANIQDNMGRTPLHAAVSADAQGVFQIL
IRNRATDLDARMHDGTTPLILAARLAVEGMLEDLVNSHADVNAVDDLGKSALHWAAAVNN
VEAAVVLLKNGANKDMQNNKEETPLFLAAREGSYETAKVLLDHFANRDITDHMDRLPRDI
AQERMHHDIVRLLDEYGLARSPQLHGTALGGAPTLSPPLCSPGSYLGNLKPAVQGKKARK
PSTKGLACGGKEAKDLKARRKKPQDGKGCLLDGSSVLSPVDSLESPHGYLSDVASPPLLP
SPFQQSPAVPLNHLPGMPDAHLGVGHLSVAAKPEMAGLGGGGRLAFEAGPPRLSHLPVAS
STSTVLGAGGGVNFTAGGAAGLNGQCEWLSRLQNGLVPNQYNPLRGNVAPGTLSTQAPAL
QHSMMGPLHAGLSTAALSQMMSYQALPSTRLAGQPHLVQTQQLPQVQPPQQNLQMQPPNL
QPQPPQPHLGVASAAGGHVGRSFLGGEPSQADVQPLGPGGGLAVHTILPQDSQALPATLA
PPMTTAQFLTPPSQHSYSSSPADNTPSHQLQVPEHPFLTPSPESPDQWSSSSPHSHVSDW
SEGISSPPTSTQSHIAHIPEALK
NT seq 7632 nt NT seq  +upstreamnt  +downstreamnt
atgccgccgctcctggcgcccctgctctgcctggcgctgctgcccgcgctcgccgcacga
ggactgcgatgttcccagcccagcgagagctgcatgaatggcgggaactgtgaagtatcc
cccaacggcacggaagcctgtgtctgtagcggtgccttcgcgggccggcgatgccaggcg
cccaacccctgcctcagcgccccctgcaagaacgcggggacgtgccacgcggtggaccac
ggcggcacggtggactacgcctgcgcctgccgcctgggcttctccgggcccctctgcctg
acgccccgggacaacgcctgcctcgccaagccctgccgcaacggcggcacctgtgacctg
ctcacgctgaccgagtacaagtgccgctgccccccgggctggtcagggaagatgtgccag
caggccgacccgtgtgcctccaacccatgtgccaacggcggccagtgcctgcccttcgag
gcctcgtacatctgccgctgcccgcccggcttccacggccccacctgcaggcaggacgtc
aacgagtgcggccagagccccgggctctgtcgcaacggaggcacctgtcacaacgaggtc
ggctcctaccgctgcacctgccgcgccacccacaccggcccccactgcgagctgccctac
gtgccctgcagcccctcaccctgccagaacgggggcacctgccgccccacgggggacacc
acccacgagtgcgcctgcctgccaggcttcaccggccagaactgcgaggagaatatcgac
gactgtcccggaaacagctgcaagaacggaggcacctgcgtggacggcgtgaacacttac
aactgccgctgcccgcccgagtggacaggccagtactgcaccgaggacgtagacgagtgc
cagctgatgcccaacgcctgccagaacggcgggacctgccacaacacccacggcggctac
aactgcgtgtgcgtcaacggctggacgggggaagactgcagcgagaacatcgatgactgt
gccagcgccgcctgcttccacggggccacctgccacgaccgagtggcctccttctactgc
gagtgtcctcatggccgcaccggtctgctttgccatctcaacgacgcctgcatcagcaac
ccttgcaacgagggctccaactgcgacaccaaccccgtcaacggcaaggccatctgcacc
tgcccctccgggtacacgggcccggcctgcagccaggacgtggacgagtgctcgctgggc
gccaacccctgtgagcacgcgggcaagtgcatcaacacgctgggctccttcgagtgccag
tgtctgcagggctacacgggcccgcgctgcgagattgacgtcaacgagtgcatctcgaac
ccgtgtcagaatgacgccacctgcctggaccagatcggggagttccagtgcatctgcatg
ccgggctatgagggcgtgcactgtgaggtcaacacggacgagtgcgccagcagcccctgc
ctccagaacggccgctgcctggacaaaatcaacgagtttctgtgcgagtgccccacaggc
ttcaccgggcacctgtgtcagtatgacgtggacgagtgtgccagcacgccttgcaggaac
ggcgccaagtgcctggacgggcccaacacctacacctgcgtgtgcacggaaggctacacg
gggccgcactgcgaggtggacattgacgagtgtgaccccgatccttgccactacgggtcg
tgcaaggatggcgttgccaccttcacctgcctgtgccggccgggctacacgggccaccac
tgcgagaccaacgtcaacgagtgtcacagccagccctgccgccacggcggcacctgccag
gaccgtgacaacgcctacctgtgcctctgcctcaaggggaccacaggacccaactgtgag
accaacctggatgactgtgccagcagcccctgtgactcaggcacgtgtctggacaagatc
gacggctacgagtgctcgtgcgagccgggctacacagggagcatgtgcaacgtcaacatc
gacgagtgtgcgggcaacccctgccaccacgggggcacctgcgaggacggcaccaacagc
ttcacctgccgctgccccgagggctaccacggccccacgtgcctgtccgaggtcaacgag
tgcagcagcaacccctgcatccacggggcctgccgggacagcctcaacgggtacacgtgt
gactgtgaccccgggtggagcggggctcactgcgacatcaacaccaacgagtgtgagtcc
aacccctgcgccaacgggggcgcctgtagagacatgaccagcggctacgtgtgcacctgc
cgcgagggcttcagtgggcccaattgccaaaccaacatcaacgagtgtgcgtctaacccg
tgcctgaaccagggctcgtgcatcgatgatgtggccggctacacgtgcaactgccccctg
ccctacacaggagccacgtgtgaggtggtgctggccccgtgcgcccccggcccctgcagg
aacggtggcgagtgccgggagtccgaggacttcgagagcttctcgtgcgtctgtcctgca
ggctggcaaggacagacgtgcgaggtcgacatcaacgagtgtgttaagaacccgtgccgc
cacggcgcctcctgccagaacaccaacggcggctaccgttgtcgctgccgcgccggctac
acggggcacaactgcgagacggacgtggatgactgccgacccaacccgtgccacaacggc
ggctcctgcacggacggcgttaacacggctttctgcgactgcctgcctggcttccggggg
gctttctgcgaggaggacatcaacgagtgcgccagcaacccctgccaccacggagccaac
tgcaccgactgcgtggacagctacacctgcacctgccccacgggcttcagcggcatccac
tgcgagaacaacacgcccgactgcacagagagctcctgtttcaacggcggcacctgcgtg
gacggcatcagctccttcacctgtctctgtccgcctggcttcacgggcagctactgccag
cacgacgtcaacgagtgtgattctcggccctgcctgcacggcggcacctgccaggacagc
tacgggacctacaagtgcacctgcccacagggctacacgggcctcaactgccagaacctc
gtgcgctggtgcgactcctcaccgtgtaagaacggcggcaagtgttggcagaccaacacc
ctgtaccgctgcgagtgccacagcggctggaccggcctctactgcgacgtgcccaacgtg
tcctgcgaggtggccgcacggcgccgagacatcaatgtcacccacctgtgccggaacggg
gggctctgcatggacgcgggcaacacgcatcactgtcgctgccaggccggctacacgggc
agctactgcgaggaccaggtggacgagtgctcgcccagcccctgccagaatggggccacc
tgcaccgactaccctggcggctactcctgcgagtgcgtggccgggtaccacggggtgaac
tgctctgaggagatcaacgagtgtctgtcccacccatgccaaaacgggggcacctgcatc
gacctcatcaacacctacaagtgttcctgtccccggggcacacagggtgtgcactgtgag
gtcaacgtggacgactgcagtcccctcatcgaccccgtctcccggggccccaagtgcttt
aacaacggcacctgcgtggaccaggtgggcggctacagctgcacctgcccacccggcttc
gtgggcgagcgctgtgagggagacgtgaacgagtgcctgtccaacccctgtgacgcccgt
ggcacccagaactgcgtgcagcgcgtcaacgacttctactgcgagtgccgtgcgggccat
actggacgccgctgtgagtcggtcatcaacggctgtaagggcaggccctgccagaacggg
ggcacctgcgccgtggcctccaacactgcccgcgggttcatctgcaagtgcccggcgggc
ttcgagggcgccacctgcgagaacgacgcacgcgcctgcgggagcctgcgctgcctcaac
ggcggcacgtgcatctcgggcccgcgcagccccacctgcctgtgcctgggccccttcacg
ggccccgagtgccagttcccggccggcagcccctgcgtgggcggcaacccctgctacaac
cagggcagctgcgagccggtgcccgagagccccttctaccgctgcctgtgcccggccaag
ttcaacgggctcctgtgccacatcctggactacagcttcgggggcggcctgggcgtcgac
atctccccgccgcagatcgaggaggcgtgcgagctgcccgagtgccgcgaggaggcgggc
aacaaggtgtgcagcctgggctgcaacaaccacgcgtgcggctgggacggcggcgactgc
tccctcaacttcaacgacccctggcagaactgctcgcagtcgctgcagtgctggaagtac
ttcagcgacggccgctgcgacagccagtgcaactcggccggctgcctattcgacggcttc
gactgccagcgcgcggacggccagtgcaaccccctgtacgaccagtactgcaaggaccac
ttcggtgacgggcactgcgaccagggctgcaacagcgcggagtgcgagtgggacgggctg
gactgcgcggagcacgtgcccgagcggctggcggccggcgcgctggtgctggtggtgctg
acgccgcccgcgcagctgcgcaacaactccctgcacttcctgcgggagctcagccgcctg
ctgcacaccaacgtggtcttcaagcgcgacgcgcacggccagcccatggtcttcccctac
tacggccgcgaggaggagctgcgcaaacaccccatcaagcgcgccgtggacggctgggcc
gcgcccggggccctgctcgaccgggtggaggccgccctgcttccgggcggcggggccggc
cgccggcgccgggagctggaccccatggacatccgcggatccatcgtctacctggagatt
gacaatcggcagtgtgtccagtcgtcctcacaatgcttccagagcgccacagacgtggcc
gccttcctgggcgccctcgcctcgctgggcagcctcaacatcccctacaagatcgaggcc
gtgcagagtgagaccgtggagccgcccccgcccccgcagctgcacttcatgtacgtggcc
gtggccgccttcgtgctcctcttctttgtgggctgcggggtgctgctgtcccgcaagcgc
cggcggcagcatggacagctctggttcccggagggcttcaaggtgtcagaggccagcaag
aagaaacggcgggagcccctcggcgaggactccgtgggcctcaagcccctgaagaacgcg
tcggatggtgctctcatggacgacagccagcacgagtggggtgacgaggatctggaggcc
aagaagttccggttcgaggagccagtggttctccccgacctggatgaccaggcagatcac
cggcagtggacccagcagcacctggacgctgccgacctgcgtgtgtccgccatggccccc
acgccaccccagggtgaggccgacgccgacagcatggatgtgaacgtccgagggccggac
ggcttcacgcccctcatgatcgcctcctgcagcggagggggtctggagacgggcaacagc
gaggaggaggaggacgcacccgccgtcatctccgacttcatctatcagggcgccagtctg
cacaaccagaccgaccgcactggcgagaccgccctgcacctggctgcccgctactcgcgc
tccgacgcggccaagcgcctgctggaagccagcgccgacgccaacatccaggacaacatg
ggacgcaccccgctgcacgcagccgtgtctgccgacgcgcagggcgtcttccagatcctg
atccggaaccgagccacggacctggacgcgcgcatgcacgatggcacgacgccgctgatc
ctggccgcccgcctggcggtggagggcatgctggaagatctcgtcaactcgcatgccgac
gtcaacgccgtggacgacctgggcaagtccgcgctgcactgggccgccgccgtgaacaac
gtggaggccgccgtcgtgctcctgaagaacggggccaacaaggacatgcaaaacaacaag
gaggagacgcccctgttcctggccgctcgggagggcagctacgagaccgccaaggtgctg
ctggaccacttcgccaaccgggacatcacggaccacatggaccgcctgcctcgtgacatc
gcgcaggagcgcatgcatcacgacatcgtgcggctgttggacgagtacggcctggcgcgc
agcccccagctgcacggcacggccctgggtggcgcgcccacgctgtccccgccgctctgc
tcccccggcagctacctgggcaacctcaagcccgccgtgcagggcaagaaggcccgcaag
cccagcaccaagggcctggcctgcggcggcaaggaggccaaagacctcaaggcacgcagg
aagaagccccaggacggcaagggctgcctgctggacggctcgagtgtgctgtcgcccgtg
gactccctcgagtcgccgcacggctacctgtcggacgtggcctcgccgccgctcctgcct
tctccgttccagcagtccccggccgtgcccctcaaccacctgcccggcatgcctgacgcc
cacctgggcgtcggccacctgagcgtggccgccaagcccgagatggcggggctgggcggg
ggcggccggctggccttcgaggcgggacccccgaggctctcccacctgcccgtggcctcc
agcaccagcacggtcctgggcgctggcggcggcgtgaatttcaccgcaggtggggccgcg
ggcttgaatggccagtgcgagtggctgtcccggctgcagaacggcctggtgcccaaccag
tacaacccgctgcgggggaacgtggcgccgggcaccctgagcacgcaggccccggccctc
cagcacagcatgatgggcccgctgcacgccggcctgtccacggccgccctgtcccagatg
atgagctaccaggccctgcccagcacgcgcctggccggccagcctcacctggtgcagacc
cagcagcttccgcaggtgcagccgccgcagcagaacttacagatgcagccgcccaacctg
cagccccagccgccccagccgcacctcggcgtggcctcggccgccggtggccacgtgggc
cggagcttcctgggcggggagccgagccaggcagacgtgcagccgctgggccccggcggc
ggcctggccgtgcacaccatcctgccgcaggacagccaggccctgcccgccacgctggcc
ccgcccatgaccaccgcgcagttcctgaccccgccctcgcagcatagctactcctcctcg
cccgcggacaacacccccagccaccagctgcaggtgcctgagcaccccttcctcaccccg
tcccccgagtcccccgaccagtggtccagctcgtcaccgcattcccacgtctctgactgg
tccgagggcatctccagcccgcccaccagcacgcagtcccacatcgcccacattccagag
gcgctcaagtaa

KEGG   Felis catus (domestic cat): 105260569Help
Entry
105260569         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: neurogenic locus notch homolog protein 4-like
  KO
K20996  Notch 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04919  Thyroid hormone signaling pathway
fca05165  Human papillomavirus infection
fca05200  Pathways in cancer
fca05206  MicroRNAs in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    105260569
 09150 Organismal Systems
  09152 Endocrine system
   04919 Thyroid hormone signaling pathway
    105260569
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    105260569
   05206 MicroRNAs in cancer
    105260569
  09162 Cancer: specific types
   05224 Breast cancer
    105260569
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    105260569
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    105260569
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_CA Notch EGF_2 EGF_3 cEGF FXa_inhibition EGF_MSP1_1
Motif
Other DBs
NCBI-GeneID: 105260569
NCBI-ProteinID: XP_023105368
Position
B2
AA seq 987 aa AA seqDB search
MQPPSLLLLLLLCHSVVKTRVLRCGDFPEPCANGGTCLSLSQGQGSCQCAPGFLGETCQF
LLPPPCQDAQLCQNGGSCQALLPALPGSPSLPSPLAPSFSCTCPSGFTGQRCQAQLKDPC
SSFCSKMGRCHIQASGRPRCSCLPGWTGEQCQLRDFCSANPCVNGGVCLATYPXIQCRCP
PGFEGHACEHDINECFLDPGPCPKGTSCHNTLGSFWCHCPTGQEGPRCELQPGPCPPTGC
PNGGTCQLVPGRDSTLHLCLCPQGFRGPSCEVNPDDCAGHQCQNGGTCPDGLSTYTCLCP
EAWTGWDCSEDVDECEAQGPPRCQNGGTCQNSAGSFHCVCVSSWGGTGCEENLDDCVAAT
CALGSTCIDRVGSFSCLCPPGRTGLLCHMEDMCLNQPCHGEAQCSTNPLTGSPLCLCQPG
YSGPTCHQDLDECQMAQQGPSPCEHGGSCLNTPGSFDCLCPPGYTGSRCEADHNECLSQP
CHLGSTCLDLLATFHCLCPPGTRWMGPSPVSLPSGHREWPPKVLPCCPLGSQQVPCCEGR
TRPSCADNPCRNRATCQDGPQGPHCLCPPGYTGDSCQTLVDICAQKPCPHNSHCLQTGPS
FQCLCLQGWTGPLCNLPLSSCQKAALSQGTEVSSLCQNGGLCIDSVSSYFCHCPPGFQGS
VCQDRVNPCESRPCQHGATCMAQPTGYLCQCAPGYNGQNCSKESNACQSQPCHNHGTCTP
KPGGFYCTCPPGFVGLRCEGDVDECLDQPCHPPGTAACHSLANAFYCQCLPGYTGQWCEV
ETDPCQSQPCSNGGSCETTAGPPLGFTCHCLQGFDGPTCNHRAPSCGHHHCHHGGLCLPS
PKPGFPPRCACLNGYGGPDCLTPPAPHGCGPPSPCLHNGSCSEIPGLGSQAFRCSCPPSS
PGPRCQRPGAKGCEGRGGDGACDAGCSGPGGNWDGGDCSLGVPDPWKGCPSLSRCWLLFR
DGQCHPQCDSAECLFDGYDCETPPACT
NT seq 2964 nt NT seq  +upstreamnt  +downstreamnt
atgcagcccccttcactgctgctgctgctgctgctgtgtcactcagtcgtcaagaccaga
gtgcttcggtgtggggacttcccagaaccctgtgccaacggaggcacctgcctgagccta
tctcagggacaagggagctgccagtgtgcccctggcttcctgggtgagacatgccagttt
ctcctaccccccccctgccaggatgcccagctctgccagaatgggggcagctgccaagct
ctgcttcccgccctcccaggctcccccagccttccctctcccttggcccccagcttctcc
tgcacctgtccctctggcttcactggccagaggtgccaggcccaactcaaggacccctgt
tcttccttctgttccaaaatgggccgctgccatatccaggcctcaggccgcccacgatgt
tcctgtctgcctggatggacaggtgagcagtgccagcttcgggacttctgctcagccaat
ccctgcgtcaatggaggggtgtgtctggccacgtaccccnagatccagtgccgctgccca
cctggcttcgagggtcatgcctgcgaacatgatatcaatgagtgtttcctggacccaggg
ccctgccccaaaggcacttcctgccataacaccttgggatctttctggtgtcactgcccc
actgggcaggagggtccacgctgtgagctccagccaggaccctgcccccctacgggctgt
cccaatgggggcacctgtcagctggttccagggagagactccaccctccacctctgcctc
tgcccccaaggtttcagaggcccgagctgtgaggtgaatccagatgactgtgctgggcac
cagtgtcagaacgggggcacttgcccggatgggctgagcacttacacgtgcctctgccca
gaggcctggacaggctgggattgctccgaagatgtggatgaatgtgaggctcagggtccc
cctcgctgccaaaatgggggtacctgccagaactcagctggcagcttccattgtgtgtgt
gtgagcagctggggaggcacaggctgtgaagagaacctagacgactgtgttgctgccacc
tgtgccctgggatccacctgcatcgatcgtgtgggctccttctcctgcctttgcccacct
ggccgcacaggactcctgtgccacatggaggacatgtgcctgaaccagccatgccacggg
gaagcccagtgcagcaccaatcccctgacaggctctccactctgcctgtgtcagcctggc
tactcggggcccacctgccaccaggacctggacgagtgtcagatggcccagcaaggcccc
agtccctgtgaacacggtggctcttgcctcaacacccctggctcctttgactgcctctgt
ccccctggctacacgggctcccgctgcgaggctgatcacaatgagtgcctgtcccagccc
tgccatctaggcagcacctgcctggacctacttgccaccttccactgcctctgcccacca
ggtactagatggatggggcccagcccagtgagcctgccgtctgggcacagagaatggccc
ccaaaggtacttccttgctgccccctcgggtcccagcaggtgccttgctgtgagggaagg
acccgtcctagctgtgcagacaacccctgtaggaacagggcaacctgccaagatggccct
cagggtccccactgcctctgcccccctggctacacaggagacagctgccagactctggtg
gacatctgtgcccagaagccctgtccacacaattcccactgcctccagactgggccctcc
ttccagtgcctgtgcctccagggatggaccgggcctctctgcaaccttccactgtcctcc
tgccagaaggctgctttgagccaaggcacagaagtttcttccctgtgccagaatggaggt
ctctgcatcgacagtgtctcctcctatttctgccactgcccccctggattccaaggcagc
gtatgtcaggacagggtgaacccatgtgagtccaggccctgccaacatggggccacgtgc
atggcccagcccactgggtatctctgccagtgtgccccaggctataatggacagaactgc
tcaaaggaatccaacgcttgtcaatcccagccctgtcacaaccatgggacctgcaccccc
aaacctggaggattctactgcacctgccctccagggtttgtggggttgcgctgtgaaggg
gacgtagatgagtgtctggaccagccctgccaccccccaggcactgcagcctgccactct
ctggccaatgctttctactgtcaatgtctgcctggatacacgggccagtggtgtgaagtg
gagacagacccttgccagagccagccctgctccaacggagggtcttgtgagacaacagca
ggaccacccctgggtttcacctgccactgcctccagggttttgacggccccacctgtaac
cacagagccccctcctgtggccaccaccactgccaccacggtggcctgtgtctgccctcc
cccaagcctggcttcccaccccgctgtgcctgcctcaatggctacgggggccctgactgt
ctgaccccacctgctcctcatggctgtggccctccttctccatgcctacacaatggcagt
tgctcagagatccctgggctggggtcccaagccttccgatgctcttgccctcccagctct
ccagggccccgctgtcagaggcctggagcaaagggatgtgagggcagaggtggagatggg
gcctgtgatgctggctgcagcggccctggaggaaattgggatgggggagactgctccctg
ggggtcccggacccctggaagggctgcccttccctctcccggtgttggcttctcttccgg
gatgggcagtgccacccacagtgtgactctgcagagtgtctgtttgatggctacgactgt
gagactcctccagcctgcacgtga

DBGET integrated database retrieval system