KEGG   Felis catus (domestic cat): 101080395Help
Entry
101080395         CDS       T02385                                 

Gene name
GLS
Definition
(RefSeq) glutaminase kidney isoform, mitochondrial isoform X4
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00220  Arginine biosynthesis
fca00250  Alanine, aspartate and glutamate metabolism
fca00471  D-Glutamine and D-glutamate metabolism
fca01100  Metabolic pathways
fca04724  Glutamatergic synapse
fca04727  GABAergic synapse
fca04964  Proximal tubule bicarbonate reclamation
fca05206  MicroRNAs in cancer
fca05230  Central carbon metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    101080395 (GLS)
   00220 Arginine biosynthesis
    101080395 (GLS)
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    101080395 (GLS)
 Organismal Systems
  Excretory system
   04964 Proximal tubule bicarbonate reclamation
    101080395 (GLS)
  Nervous system
   04724 Glutamatergic synapse
    101080395 (GLS)
   04727 GABAergic synapse
    101080395 (GLS)
 Human Diseases
  Cancers
   05230 Central carbon metabolism in cancer
    101080395 (GLS)
   05206 MicroRNAs in cancer
    101080395 (GLS)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     101080395 (GLS)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glutaminase Ank_2 Ank_4 Ank_3 Ank_5 Ank
Motif
Other DBs
NCBI-GeneID: 101080395
NCBI-ProteinID: XP_019693945
Ensembl: ENSFCAG00000028164
Position
C1
AA seq 445 aa AA seqDB search
MSFTSHIDELFESAKKQSGGKVADYIPQLAKFSPDLWGVSVCTVDGQRHSIGDTKVPFCL
QSCVKPLKYAIAVNDLGTEYVHRYVGKEPSGLRFNKLFLNEDDKPHNPMVNAGAIVVTSL
IKQGVNNAEKFDYVMQFLNKMAGNEYVGFSNATFQSERESGDRNFAIGYYLKEKKCFPEG
TDMVGILDFYFQLCSIEVTCESASVMAATLANGGFCPITGERVLSPEAVRNTLSLMHSCG
MYDFSGQFAFHVGLPAKSGVAGGILLVVPNVMGMMCWSPPLDKMGNSVKGIHFCHDLVSL
CNFHNYDNLRHFAKKLDPRREGGDQRVKSVINLLFAAYTGDVSALRRFALSAMDMEQRDY
DSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQV
QYTPQGDSDNGKENQTVHKNLDGLL
NT seq 1338 nt NT seq  +upstreamnt  +downstreamnt
atgtcttttacctctcacattgatgagttatttgaaagtgctaaaaagcagtctggagga
aaggttgcggattatattcctcagctagccaagttcagtcctgatttgtggggtgtatct
gtgtgtacagtagatggacagaggcattctattggagataccaaagttccattttgtctt
cagtcctgtgtaaaacctttgaaatatgcaattgctgttaatgaccttggaacagaatat
gtgcatcgatatgttgggaaagagccaagtggattaagattcaacaaactgtttttaaat
gaagatgataagccacacaatcctatggtaaatgctggagcaattgttgtgacttcatta
ataaagcaaggagtgaataatgctgaaaaatttgactatgtgatgcagtttttgaataag
atggctggcaatgaatacgttggattcagtaatgcaacgtttcagtctgaaagagaaagt
ggagatcgaaattttgcaataggatattacctaaaagaaaaaaagtgttttccagaaggc
acagacatggttggtatattagacttctatttccagctatgctccattgaagtaacttgt
gaatcagccagtgtgatggctgcaacactggctaatggtggtttctgtccaattactggt
gagagagtactgagccctgaagcagttcgaaatacactgagtttgatgcattcctgtggc
atgtatgatttctccgggcagtttgctttccatgttggtcttcctgcaaaatctggagtt
gctgggggcattcttttagttgtccctaatgtcatgggcatgatgtgctggtctcctcct
ctggacaagatgggcaacagtgttaagggaattcacttctgtcatgatcttgtttctctc
tgtaatttccataactatgataatttgagacactttgcaaaaaaacttgatcctcgaaga
gaaggtggtgatcaaagggtgaagtcagtgataaaccttttgtttgctgcgtatactgga
gatgtatctgcacttcgaagatttgctctatcagccatggacatggaacagcgagactat
gactctagaacagcactgcatgtagctgctgcagagggtcatgttgaagttgttaaattt
ttgctggaggcatgcaaagtaaatcctttccccaaggacaggtggaataacactcccatg
gatgaagcgctgcacttcggacaccacgatgtatttaagatcctccaggaataccaagtg
cagtacacgcctcaaggagattccgacaacggaaaagaaaatcaaacggtccataagaat
ttggatggattgttataa

DBGET integrated database retrieval system