KEGG   Felis catus (domestic cat): 101080463Help
Entry
101080463         CDS       T02385                                 

Gene name
PTPRR
Definition
(RefSeq) receptor-type tyrosine-protein phosphatase R isoform X2
  KO
K04458  receptor-type tyrosine-protein phosphatase R [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101080463 (PTPRR)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101080463 (PTPRR)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101080463 (PTPRR)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Receptor PTPs
    101080463 (PTPRR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3 CyRPA PTPlike_phytase DUF1999
Motif
Other DBs
NCBI-GeneID: 101080463
NCBI-ProteinID: XP_011282425
Ensembl: ENSFCAG00000006180
Position
B4
AA seq 533 aa AA seqDB search
MDVNRLNITLLRIFRQGVAAALGLLPQQVHINRLIGKKNSVELFVSPINRKAGISDALPS
EEVLRSLNINVLHQSLSQFGIIEVSPEKNVLQGQHEADKIWSKEGFYAVVIFLSIFVIIV
TCLMILYRLKEKFQFSLRQDKEKNQEIHLSPIALQPAQSEAKTVNSMVQPEQAPKVLNVV
VDPQGRYTPEIKATTAVCPSPFKMKPIGLQERRGSNVSLTLDMSSLGNVEPFVAIPTPRE
KVAMEYLQSASRILTRSQLRDVVASSHLLQSEFMEIPMNFVDPKEIDIPRHGTKNRYKTI
LPNPLSRVCLRPKNVTDSLSTYINANYIRGYSGKEKAFIATQGPMINTVNDFWQMVWQED
SPVIVMITKLKEKNEKCVLYWPEKRGIYGKVEVLVINVNECDNYTVRNLVLKQGGHTQHV
KHYWYTSWPDHKTPDSAQPLLQLMLDVEEDRLAATGRGPVVVHCSAGIGRTGCFIATSIG
CRQLKEEGVVDALSIVCQLRVDRGGMVQTSEQYEFVHHALCLYESRLSAETVQ
NT seq 1602 nt NT seq  +upstreamnt  +downstreamnt
atggatgtaaacaggctgaacataaccttgcttcggatattccgccaaggagtggctgca
gctttaggactcttaccccagcaagtgcacatcaatcgcctcattggaaagaagaacagt
gttgaactatttgtgtctcctataaaccgaaaagcaggaatttcggatgctctcccatct
gaggaagtgctgcgttcacttaatataaatgtcttacatcaaagtttatctcaatttgga
attatagaagtctcccctgagaaaaatgttttacaagggcagcatgaagcggacaaaatc
tggagcaaagaaggattttatgctgttgtcatttttctcagcatctttgttattatagta
acgtgtttgatgattctttacagattaaaagaaaagtttcagttttccttgcgacaagat
aaagagaaaaatcaggagatccacctatcacccattgcattacagccagcacagtctgag
gcaaagacagtcaacagcatggtccagcccgagcaagccccaaaggtgctgaatgtggtt
gtggaccctcaaggccgatacactcctgagatcaaagctaccaccgctgtctgcccttct
cctttcaaaatgaagcccataggacttcaggagagacgagggtccaacgtatctcttaca
ttggacatgagtagcttggggaatgttgaaccttttgtggctatcccaaccccacgggag
aaggtagcaatggagtatctgcagtcagccagccgaatcctcacaaggtcacagctgagg
gacgtcgtggcaagttcacatttactccaaagtgaattcatggaaattccaatgaacttt
gtggatcccaaagaaattgacattccacgtcatggaactaaaaatcgctataagaccatt
ttgccaaaccccctaagcagagtgtgtttaagaccaaaaaatgtaactgattctttgagc
acctacattaatgctaattatattcggggctacagtggcaaagagaaagctttcatcgcc
acacagggccccatgatcaacaccgtgaatgatttctggcagatggtttggcaggaagac
agtcccgtgattgttatgatcacaaaactcaaagaaaaaaatgagaaatgtgtgttatac
tggccagaaaagagaggaatttatgggaaagttgaggttctggttatcaatgtaaatgaa
tgtgataactacaccgttcgaaaccttgtcttaaagcaaggaggtcacacccagcatgtg
aagcattactggtacacctcatggccggatcacaagactccagacagtgcccagcccctt
ctacagctcatgctggatgtagaagaagacaggcttgctgccacgggccgagggcccgtg
gtcgtccactgcagcgcagggataggtagaacggggtgttttattgccacatccattggc
tgtcgacagttgaaagaagaaggagttgtcgatgcactaagcattgtctgccagcttcgt
gtagacaggggtggaatggtccaaactagtgagcagtatgaatttgtacatcatgctctg
tgcctgtatgagagcagactttcagcagaaactgtccagtga

KEGG   Felis catus (domestic cat): 101081668Help
Entry
101081668         CDS       T02385                                 

Gene name
PTPN5
Definition
(RefSeq) tyrosine-protein phosphatase non-receptor type 5 isoform X3
  KO
K18018  tyrosine-protein phosphatase non-receptor type 5 [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101081668 (PTPN5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101081668 (PTPN5)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101081668 (PTPN5)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101081668 (PTPN5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 101081668
NCBI-ProteinID: XP_019667713
Ensembl: ENSFCAG00000002890
Position
D1
AA seq 501 aa AA seqDB search
MNYEEARSEREKHPADDSEGGALDMCCSEKLPGHPQPVVMEALDQAEGLADSPREMPPPP
PPSQPSEPAQKPPPRGVGSHSLPVRNSLCLLAASQFLVWHLLRAPPEPPAPPRPEDRRQS
VSRQPSFTYSEWMEEKVEDDFLDLDPVPETPVFDFVMDIKPEADPASLTVKSMGLQERRG
SNVSLTLDMCTPGCNEEGFGYLMSPREESAREYLLSASRVLQAKELHEKALDPFLLQAEF
FEIPMNFVDPKEYDIPGLVRKNRYKTILPNPHSRVCLTSPDPDDPLSSYINANYIRGYGG
EEKVYIATQGPIVSTVSDFWRMVWQEQTPIIVMITNIEEMNEKCTEYWPEEQVMYDGVEI
TVQKVIHTEDYRLRLISLRSGTEERGLKHYWFTSWPDQKTPDRAPPLLHLVREVEEAARQ
EGPRCAPIVVHCSAGIGRTGCFIATSICCQQLRQEGVVDILKTTCQLRQDRGGMIQTCEQ
YQFVHHVMSLYEKQLSRQSPE
NT seq 1506 nt NT seq  +upstreamnt  +downstreamnt
atgaattatgaggaagccaggagtgagagagagaagcaccctgctgatgactccgaggga
ggggccctggacatgtgctgcagcgagaagctgccgggtcacccccagccggtagtgatg
gaggcgctggaccaggccgaagggctcgcggactctccgagagaaatgccaccgccccca
ccgccttcacagccctcagagccagctcagaagccaccacctcgaggcgtcgggagccac
tccctccctgtcaggaacagcctgtgcctgttggccgcctcccagttcctggtgtggcac
ctcctgagggctcccccagagccacccgccccaccgcgccctgaggatagacgccagtcc
gtgagccgccagccttccttcacctactccgagtggatggaagagaaggtcgaggatgac
ttcctagacctggaccctgtccctgagactcctgtgtttgacttcgtgatggacatcaag
ccagaggccgacccggcctcactcaccgtcaagtccatgggtctacaggaaaggaggggc
tccaatgtctccctgaccctggacatgtgcacaccaggctgcaatgaggagggcttcggc
tatctcatgtccccacgtgaggagtcagcccgcgagtacctgctcagcgcctcccgtgtc
ctgcaggccaaggagcttcacgagaaggccctggaccccttcctgctgcaggcagaattc
tttgaaatccccatgaactttgtggatccgaaggagtatgacatccctgggctggtgcgg
aagaaccggtacaaaaccatccttcccaacccccacagcagagtatgtctgacctcgcca
gaccccgatgaccctctgagttcctacatcaacgccaactacatccggggctacggtggg
gaggagaaggtgtacattgccacgcagggacccatcgtcagcacggtcagcgacttctgg
cgcatggtgtggcaggagcagacacccatcatcgtcatgatcaccaacatcgaggagatg
aatgagaagtgcactgagtattggccggaggagcaggtgatgtacgacggagtggagatc
actgtgcagaaagtcattcataccgaggattaccggctgcgactcatctccctcaggagc
gggaccgaagagcgaggcctgaagcattactggttcacgtcctggcccgaccagaagacc
ccagaccgggcccccccactcctgcacctggtgcgggaggtggaggaggccgcccggcag
gaggggccccgctgcgcccccatcgtcgtccactgcagtgcagggattgggaggacgggc
tgcttcatcgccaccagcatctgctgccagcagctgcggcaggagggagtggtggacatc
cttaagaccacgtgccagctccgtcaggacaggggcggcatgatccagacatgtgagcaa
taccagtttgtacaccatgtcatgagcctctacgagaagcagctgtcacgccagtcccca
gagtga

KEGG   Felis catus (domestic cat): 101098110Help
Entry
101098110         CDS       T02385                                 

Gene name
PTPN7
Definition
(RefSeq) LOW QUALITY PROTEIN: tyrosine-protein phosphatase non-receptor type 7
  KO
K18019  tyrosine-protein phosphatase non-receptor type 7 [EC:3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101098110 (PTPN7)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    101098110 (PTPN7)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.48  protein-tyrosine-phosphatase
     101098110 (PTPN7)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Classical)
   Non-receptor PTPs
    101098110 (PTPN7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Y_phosphatase DSPc Y_phosphatase3
Motif
Other DBs
NCBI-GeneID: 101098110
NCBI-ProteinID: XP_019677527
Ensembl: ENSFCAG00000029086
Position
F1
AA seq 449 aa AA seqDB search
MNQLGCWPERGLPRQGGGWGGGMGGGQWNLGRGGHFLGPRHPDAPEAKKTCESPRVRARD
CPLSVRLLSFRXTSWLSKPPLGPAPHXQHGPGPWWGCSRARLPTWSLGAAMTQPPPTKAP
AKKHVRLQERRGSNVALMLDVRSLGAVEPICSVNTPREVTLHFLRTAGHPLTRWALQHQP
PSPKQLEEEFLKIPSNFVNSEDLDIPGHASKDRYKTILPNPQSRVCLGRAQSQEDGDYIN
ANYIRGYDGQEKVYIATQGPMPNTVSDFWEMVWQEEVSLIVMLTQLREGKEKCVHYWPTE
EETYGPFRIRIQGTKECPEYTVRQLTIQHQEECRVVKHVLFSAWPDHQTPESAGPLLRLV
AEVEESPETAANTGPIVVHCSAGIGRTGCFIATRIGCQQLKARGEVDILGIVCQLRLDRG
GMIQTTEQYQFLHHTLALYAAQLPEEPCP
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
atgaaccagctgggctgctggccagaaaggggcctgccgaggcaaggcggggggtggggg
ggtgggatggggggtgggcagtggaatcttggacgtgggggccacttcctaggccccagg
catccagatgccccagaggcgaagaagacgtgcgagtccccccgtgtgagggccagagac
tgtccactatctgtaaggctcctgtctttcaggtgaacctcatggctgagtaagcctccc
ctgggcccagcaccccacnnccagcatggtccaggaccgtggtgggggtgctccagagca
cggctgccgacctggtctttgggggcagccatgacccagcctccacccaccaaagcacca
gccaagaagcatgtgcgactgcaggagaggcgaggctccaatgtggctctgatgctggat
gtgcggtccctgggagctgtagagcccatttgctcagtgaacacaccccgggaggtcacc
ctacactttctgcgcacagctggacaccccctcacccgctgggccctgcagcaccagcca
cccagccccaagcagctggaagaggaattcctgaagatcccctcaaactttgtcaactct
gaagacctggatattcctggccacgcctccaaggaccgatataagaccatcttgccaaat
ccccagagccgcgtctgtctaggccgggcacagagccaagaagacggagactacatcaat
gccaactacatccgaggctacgacgggcaggagaaggtctacattgcgacccagggcccc
atgcccaacaccgtatcggacttctgggagatggtgtggcaggaagaagtgtcactcatt
gtcatgctcactcagctccgagaaggcaaggagaaatgtgtccactactggcccacagaa
gaggaaacctatggacccttccggatccgcatccaaggcacaaaagaatgtccagaatac
actgtgcggcagctcaccatccagcaccaggaggagtgccgggtagtgaaacatgtcctc
ttctctgcctggcctgatcaccagaccccagaatcggctgggcctctgctgcgcctggtg
gccgaggtggaggaaagcccagagacagctgccaacactgggcccatcgtagtccactgc
agtgcagggattggccggactggctgcttcatcgccacccgaattggctgtcaacagctg
aaggcccgaggggaagtggacattctgggtatcgtgtgccaactgcggctggacaggggc
gggatgatccagaccacagagcaataccagttcctgcaccacaccctggccctgtatgca
gcccagctaccggaggagccctgcccctga

KEGG   Felis catus (domestic cat): 102899577Help
Entry
102899577         CDS       T02385                                 

Gene name
DUSP3
Definition
(RefSeq) dual specificity protein phosphatase 3
  KO
K17614  dual specificity phosphatase 3 [EC:3.1.3.16 3.1.3.48]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    102899577 (DUSP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fca01009]
    102899577 (DUSP3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     102899577 (DUSP3)
    3.1.3.48  protein-tyrosine-phosphatase
     102899577 (DUSP3)
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Atypical DSPs
    102899577 (DUSP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DSPc Y_phosphatase Init_tRNA_PT Y_phosphatase2 DUF442 Myotub-related
Motif
Other DBs
NCBI-GeneID: 102899577
NCBI-ProteinID: XP_023099342
Position
E1
AA seq 185 aa AA seqDB search
MSGPFELSVQDLNDLLSDGSGCYSLPSQPCNEVTPRIYVGNASVAQDIPKLQKLGITHVL
NAAEGRSFMHVNTNANFYKDSGITYLGIKANDTQEFNLSAYFERAADFIDQALAQKNGRV
LVHCREGYSRSPTLVIAYLMLRQKMDVKSALSIVRQNREIGPNDGFLAQLCQLNDRLVKE
GKLKL
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggcccgttcgagctctcggtgcaggatctcaacgacctgctctcggacggcagc
ggctgctacagcctgccgagccagccctgcaacgaggtcaccccgaggatctacgtgggc
aacgcgtcggtggctcaagacatccccaagctgcagaaactaggcatcacccatgttctg
aatgctgctgagggcaggtccttcatgcacgtcaacaccaacgccaacttctacaaggac
tccggcatcacctacctgggcatcaaagccaatgacacgcaggagttcaacctcagcgcc
tactttgaaagggctgcagacttcattgaccaggccttggctcaaaagaacggccgggtg
cttgtccactgccgggaaggttacagccgctccccaaccctagtcatcgcgtacctcatg
ttgcgccagaagatggatgtcaagtccgcgctgagcatcgtgaggcagaaccgtgagatc
ggccccaacgatggtttcctggctcagctctgccagctcaatgacagactggtcaaggag
gggaaattgaaactctag

DBGET integrated database retrieval system