KEGG   Felis catus (domestic cat): 101080520Help
Entry
101080520         CDS       T02385                                 

Gene name
NFATC2
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 2 isoform X1
  KO
K17332  nuclear factor of activated T-cells, cytoplasmic 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04370  VEGF signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04921  Oxytocin signaling pathway
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101080520 (NFATC2)
   04370 VEGF signaling pathway
    101080520 (NFATC2)
   04022 cGMP-PKG signaling pathway
    101080520 (NFATC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101080520 (NFATC2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101080520 (NFATC2)
   04650 Natural killer cell mediated cytotoxicity
    101080520 (NFATC2)
   04660 T cell receptor signaling pathway
    101080520 (NFATC2)
   04658 Th1 and Th2 cell differentiation
    101080520 (NFATC2)
   04659 Th17 cell differentiation
    101080520 (NFATC2)
   04662 B cell receptor signaling pathway
    101080520 (NFATC2)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101080520 (NFATC2)
  09158 Development
   04360 Axon guidance
    101080520 (NFATC2)
   04380 Osteoclast differentiation
    101080520 (NFATC2)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101080520 (NFATC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080520 (NFATC2)
   05170 Human immunodeficiency virus 1 infection
    101080520 (NFATC2)
   05161 Hepatitis B
    101080520 (NFATC2)
   05163 Human cytomegalovirus infection
    101080520 (NFATC2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101080520 (NFATC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101080520 (NFATC2)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101080520 (NFATC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Motif
Other DBs
NCBI-GeneID: 101080520
NCBI-ProteinID: XP_023106861
Position
A3
AA seq 920 aa AA seqDB search
MDAPEPQPDPDGGDAPGHEPGGSPQDEFDFSILFDYDYLNPIEEEPNAHKVASPPSGLAY
PDDVLDYGLKPYSPLPSLPGEPPGRFGEPDRVGPQNFLSAAQPAGASGLSPRIEITPSHE
LMQAGGPLRGRDAGLLGEQPALAGAAASPRFTLPVPGFEGYREPLCLSPASSGSSASFVS
DTFSPYTSPCVSPNNGGPDDLCPQFQNIPAHYSPRTSPIMSPRTGLAEDSCLGRRSPAPR
PASRSSSPGAKRRHSCAGAPVAPLPGASPQRSRSPSPQPRDDGAPAGYPAAAGSAVLMDA
LNSLAADSPCGIPPKMWKTSPEPAPASAAPPKAGLPRHLYPAAVEFLGPCEQEERRNSAP
ESILLMPPTWPKQLVPALPLCSIPVTASLPPLEWPLSHQSGSYELRIEVQPKPHHRAHYE
TEGSRGAVKAPTGGHPVVQLHGYMENKPLGLQIFIGTADERILKPHAFYQVHRITGKTVT
TTSYEKIVGNTKVLEIPLEPKNNMRATIDCAGILKLRNADIELRKGETDIGRKNTRVRLV
FRVHIPEASGRIISLQTASNPIECSQRSAHELPMVERQDIDSCLVYGGQQMILTGQNFTA
ESKVVFTEKTTDGQQIWEMEATVDKDKSQPNMLFVEIPEYRNKHIRASVKVNFYVINGKR
KRSQPQHFTYHPVPAIKTEPTDEYDPTLICSPAHGGLGSQPYYPQHPMVAESPSCLVATM
APCQQFRSGLSSPDARYQQQNPAAVLYQRSKSLSPSLLGYQQPALMAAPLSLADAHRSVL
VHAGSQGQSSSLLHSSPANQQASPVIHYSPTGQQLRCGGHQEFQHIMYCENFAPGTARPG
PPPASQGQRLSPGSYPTVIQQQNATSQRAAKNGPPVSDQKEVLPAGVTIKQEQNLDQTYL
DDVNEIIRKEFSGPPARNQT
NT seq 2763 nt NT seq  +upstreamnt  +downstreamnt
atggacgccccggagccgcagcccgaccccgacggcggggacgccccaggccacgagccc
gggggcagcccccaagacgagttcgacttctccatcctcttcgactatgactatttgaat
cctatcgaagaagaaccgaatgcacataaggtcgccagcccaccctccggactcgcatac
cccgatgatgtcctggactatggcctcaagccatacagccccctccccagtctcccgggc
gagccccccggccgattcggagagccggatagggtagggccgcagaactttctgagcgcg
gcccagccagccggggcctcgggcctgagccctcggatcgagatcactccatctcacgaa
ctgatgcaggcagggggccccctccgcgggagagacgctggcctgctgggggagcagccg
gccctggccggggcggccgccagcccgcggttcacgctgcccgtgcccggcttcgagggc
taccgcgagccgctttgcttgagcccggctagcagcggctcctctgccagcttcgtttcc
gacaccttctccccctacacctcgccctgcgtctcgcccaataacggcgggcccgacgac
ctgtgcccccagtttcaaaacatccctgctcattattcccccagaacctcgccaataatg
tcacctcgaaccggcctcgctgaggacagctgcctgggccgccgctcgcccgcgccccgt
ccggcctcccgctcctcgtcgcctggcgccaagcggaggcattcgtgtgccggggccccg
gtcgccccgctgcccggagcctcgccccagcgctcccggagcccctcgccgcagccccgg
gacgacggcgcccccgccggctaccccgccgcggccggctccgccgtcctcatggacgcc
ctgaacagcctcgccgccgactcgccctgcggcatcccccccaagatgtggaagaccagc
cccgagccggcgcccgcgtccgccgccccgcccaaggccggcctgccccgccacctgtac
ccggccgccgtggaatttctgggcccctgcgagcaggaggagaggaggaactcggccccc
gagtccatcctgctgatgccgcccacgtggcccaagcagctggtgcccgcccttcccctc
tgcagtattccagtgaccgcatccctccctccgcttgagtggccactctcccaccagtcg
gggtcctatgagctgcggattgaggtgcagcccaagccacatcaccgggcccactatgag
acagaaggcagccgaggggctgtcaaagctccaactggtggccaccctgtcgttcagctc
catggctacatggaaaacaagcccctcgggcttcagatcttcattgggacagccgacgag
cggatcctgaagccccacgccttctaccaggtgcaccgcatcacgggaaaaaccgtcacc
accaccagctacgagaagatcgtaggcaacaccaaagtcctggagatccctctggagcca
aagaacaacatgagggcgaccattgactgtgcggggatcctgaagctgaggaacgcggac
atcgagctgcggaaaggcgagacggacatcggcaggaagaacacgcgggtgcggctggtt
ttccgggtgcacattccagaggccagcgggaggatcatctccctgcagactgcatccaac
cccatcgaatgctcccagcgatccgcccacgagctgcccatggtggaaagacaggacatc
gacagctgcctggtctacgggggccagcagatgatcctcacgggacagaacttcacagcc
gagtccaaagtcgtgtttactgagaagaccacagatgggcagcaaatttgggaaatggaa
gccacggtggataaagacaagagccagcctaacatgctttttgttgagatccctgaatat
cgaaacaagcacatccgtgcatcggtgaaggtcaacttctacgtcatcaatgggaaaaga
aaacggagtcaacctcagcactttacttaccacccagtcccagccatcaagacggagccc
accgacgaatacgaccccaccttgatctgcagcccggcccacgggggcctggggagccag
ccttactacccgcagcacccgatggtggctgagtccccctcctgcctcgtggccaccatg
gcgccctgccaacagttccgctcggggctctcgtcccccgacgcccgctaccagcagcag
aacccagcggccgtcctctaccagcggagcaagagcctgagccccagcctgctgggctac
cagcagccggccctcatggccgcccccctgtccctggcggacgcccaccgctccgtgctg
gtgcacgccggctcccagggccagagctccagcctgctgcactcctctccggccaaccag
caggcctcgccggtgatccactactcgcccaccggccagcagctgcgctgcggtggccac
caggaattccagcacatcatgtactgcgagaatttcgcgcccggcaccgccaggcccggc
ccgccccccgccagtcaaggtcagaggctgagcccggggtcctaccccacggtcattcag
cagcagaatgccaccagccaaagagccgccaaaaacggacccccggtcagtgaccaaaag
gaagtattacccgcaggagtgacaattaagcaggagcagaatttggaccagacctacttg
gacgacgttaatgaaattatcaggaaggagttttcaggacctcccgccagaaatcagacg
tag

KEGG   Felis catus (domestic cat): 101083728Help
Entry
101083728         CDS       T02385                                 

Gene name
NFATC3
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 3 isoform X1
  KO
K17333  nuclear factor of activated T-cells, cytoplasmic 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04625  C-type lectin receptor signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04921  Oxytocin signaling pathway
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101083728 (NFATC3)
   04310 Wnt signaling pathway
    101083728 (NFATC3)
   04022 cGMP-PKG signaling pathway
    101083728 (NFATC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101083728 (NFATC3)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101083728 (NFATC3)
   04660 T cell receptor signaling pathway
    101083728 (NFATC3)
   04658 Th1 and Th2 cell differentiation
    101083728 (NFATC3)
   04659 Th17 cell differentiation
    101083728 (NFATC3)
   04662 B cell receptor signaling pathway
    101083728 (NFATC3)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101083728 (NFATC3)
  09158 Development
   04360 Axon guidance
    101083728 (NFATC3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101083728 (NFATC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101083728 (NFATC3)
   05170 Human immunodeficiency virus 1 infection
    101083728 (NFATC3)
   05161 Hepatitis B
    101083728 (NFATC3)
   05163 Human cytomegalovirus infection
    101083728 (NFATC3)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101083728 (NFATC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101083728 (NFATC3)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101083728 (NFATC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_dimer RHD_DNA_bind TIG
Motif
Other DBs
NCBI-GeneID: 101083728
NCBI-ProteinID: XP_011288393
Ensembl: ENSFCAG00000030997
UniProt: M3X7E0
Position
E2
AA seq 1075 aa AA seqDB search
MTTANCGAHDELDFKLVFGEDGAPAPPSSGSRPADLEPDDCASIYIFNVDPPPSTLNSPL
CLPHHGLPSHSSVLSPSFQLQGHKNYEGTCEIPESKYSPLSGPKPFECPSIQITSISPNC
HQEIDTHEDDLHINDPEREYLERPSRDHLYLPLEPSYRESSLSPSPASSISSRSWFSDAS
SCESLSHIYDDVDSELNEAAARFTLGSPLTSPGGSPGGCPGEESWHQQYGLGHSLSPRQS
PCHSPRSSVTDENWLSPRPASGPSSRPTSPCGKRRHSSAEVCYAGSLSPHHSPVPSPGHS
PRGSVTEDTWLNASVQGGSGLGPALFPFQYCVETDIPLKTRKTSEDQATILPGKLELCSD
DQGSLSPSRETSVDDGLGSQYPLKKDSSGDQFLSVPSPFTWSKPKPGHTPIFRTSSLPPL
DWPLPTHFGQCELKIEVQPKTHHRAHYETEGSRGAVKASTGGHPVVKLLGYNEKPINLQM
FIGTADDRYLRPHAFYQVHRITGKTVATASQEIIIASTKVLEIPLLPENNMSASIDCAGI
LKLRNSDIELRKGETDIGRKNTRVRLVFRVHIPQPNGKVLSLQTASIPVECSQRSAQELP
HIEKYSINSCSVNGGHEMIVTGSNFLPESKIIFLEKGQDGRPQWEVEGKIIREKCQGAHI
VLEVPPYHNPAVTAAVQVHFYLCNGKRKKSQSQRFTYTPVLMKQEHKEEVDLSSVPSLSV
PHPAQTQRPSSDTGHPHNSVLSTQRSLVCPIQQTYASMVTSSHLPQLQCRDESAGKEQHM
LPSSVMHQPFQVTPTPPVGSSYQPMQTNVVYNGPTCLPVNAASSQEFDPVLFPQDAALPT
LINLGCQPSSSIPFHSSNSGPTGHLLAHTPHSVQTLPHLQSMGYHCSTTGQRSLSSPGAD
QVAGQPSPQLQPITYGPSHSGSGTAASPVASHPLASSPLSGPPSPQLQPMPYQSPSSGTA
SSPSLATRMHSGQHSTQAQSTGQGGLSAPSSLICRNLCDPASFPPDEATVNIKPEPEEQE
PNFSTIGLQDITLDDVNEIIGRDMSQISVSQGTGASRQAPLPGPDSLDLGRSDGL
NT seq 3228 nt NT seq  +upstreamnt  +downstreamnt
atgactactgcaaactgtggcgcccacgacgagctcgacttcaaactcgtctttggcgag
gacggggcgccggcgccgccgtcctcgggctcgcggcctgcagatcttgagccagatgat
tgtgcatccatttacatctttaatgtagatccacctccatctactttaaactcaccactt
tgcttaccacatcatggattaccgtctcactcttctgttttgtcaccatcgtttcagctc
caaggtcacaaaaactatgaaggaacttgtgagattcctgaatctaaatacagcccttta
agtggtcccaaaccctttgagtgtccaagtattcaaattacatccatctctcctaactgt
catcaagaaatagatactcatgaagatgacctacacataaatgatccagaaagggaatat
ttggaaaggccttctagagatcatctctatcttcctcttgagccatcctaccgggagtct
tcccttagtcctagtcctgccagcagcatctcttctaggagctggttctcagatgcatct
tcttgcgaatctctttcacacatttatgatgatgtggattcggaattgaatgaagctgcc
gcccgatttactcttggatcccctctgacttctcctggtggctcaccaggaggttgccct
ggagaagagtcctggcatcaacaatatggacttggacactccttgtcacccaggcaatct
ccttgccactctcctagatctagtgttactgatgagaattggctgagccccaggccagcc
tcaggaccctcatcaaggcctacttccccctgtgggaaacgacggcactccagtgctgag
gtttgttatgctgggtccctttcaccccatcattcacctgttccttctcctggtcactcc
cccaggggaagtgtaacagaagatacctggcttaatgcttctgtccagggtggatcaggc
cttggccctgcactttttccatttcagtactgtgtagagactgatatccctctgaaaaca
aggaagacttctgaagatcaagctaccatactaccaggaaaattagagctctgttcagat
gaccaagggagtttatcaccatcccgggagacttcagtagatgatggccttggatctcag
tatcctttaaagaaagattcatctggtgaccaatttctttcagttccttcaccttttacc
tggagcaaaccaaagcctggccacaccccaatatttcgcacatcttcattacctccacta
gactggcctttaccaactcattttggacaatgtgaactgaaaatagaagtgcaacctaaa
actcatcatcgagcccattatgaaactgaaggtagccgaggagcagtaaaagcatctact
gggggacatcctgttgtcaagctcctgggctataatgaaaagccgataaatctacagatg
tttattggaacagcagatgatcgatatttacgacctcatgcattttatcaggtgcatcga
atcactgggaagactgttgctactgcaagtcaagagataataattgccagcacaaaggtt
ctggaaattccccttcttcctgaaaacaatatgtcagccagtattgactgtgcaggtatt
ttgaaactccgcaattcagatatagaacttcgaaaaggagaaactgatattggcagaaag
aatactagagtacgacttgtattccgtgtgcacatcccacagcccaatggaaaagtcctt
tctcttcagacagcttccatacctgttgagtgctctcagcggtctgctcaagaacttcct
catattgagaagtatagtatcaacagttgttctgtaaatggaggtcatgaaatgattgtg
actggatctaattttcttccagaatccaaaatcatttttcttgagaaaggacaagatgga
cgacctcagtgggaggtagaagggaaaataatccgggaaaaatgtcaaggggctcacatt
gtccttgaagttcctccatatcataacccagcagttacagctgcagtgcaggtgcacttt
tatctttgcaatggcaagaggaaaaaaagccagtctcaacgttttacttatacaccagtt
ttgatgaagcaagaacacaaagaagaggttgacttgtcttcagttccgtcattgtctgtg
cctcatcctgcccagacccagaggccttcttcagacacaggacacccacataacagtgta
ctgtcaacacagagaagcttggtttgtcccatccagcaaacatatgcatccatggtaact
tcatctcatctgccacagttgcagtgtagggatgaaagcgctggtaaagaacagcatatg
ttaccttcttcagtcatgcaccagccttttcaagtcacaccaacacctcctgtggggtct
tcctatcaacctatgcaaactaatgttgtgtacaacggaccaacttgtcttccagttaat
gctgcctctagtcaagaatttgatccggttttgtttccacaggatgcagctcttcctact
ttaataaatcttggctgtcaaccatcgtcatccataccttttcattcttcaaattcaggc
ccaacaggacatctcttagcccacacacctcattcggtacagaccctgcctcatcttcag
tcaatgggataccactgttcaaccacaggacagagatctctttcttctccaggggctgac
caggtcgcaggccagccttcccctcagttacagcccattacatatggtccttcacattca
gggtctggtacagcagcttccccagtagcctctcatcccctggctagttcaccactttct
gggccaccatctcctcagctacagcctatgccttaccaatctcctagctcaggaactgcc
tcatcaccatctctagccaccagaatgcattctggacagcactcaactcaagcacaaagt
acaggccagggaggtctttctgcaccttcatccttaatatgtcgcaatttgtgtgatcca
gcttcatttccacctgatgaggcaactgtgaacattaagcctgaacctgaagagcaggaa
cctaacttttcaacaattggtctacaggacatcactttagatgatgtgaacgagataatt
gggagagacatgtcccagatttctgtttcccaaggaacaggggcgagcaggcaggctccc
ctccctggtcccgattccctggatttgggaagatccgatgggctctga

KEGG   Felis catus (domestic cat): 101098235Help
Entry
101098235         CDS       T02385                                 

Gene name
NFATC4
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 4
  KO
K17334  nuclear factor of activated T-cells, cytoplasmic 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04360  Axon guidance
fca04625  C-type lectin receptor signaling pathway
fca04921  Oxytocin signaling pathway
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101098235 (NFATC4)
   04022 cGMP-PKG signaling pathway
    101098235 (NFATC4)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101098235 (NFATC4)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101098235 (NFATC4)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101098235 (NFATC4)
  09158 Development
   04360 Axon guidance
    101098235 (NFATC4)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101098235 (NFATC4)
   05170 Human immunodeficiency virus 1 infection
    101098235 (NFATC4)
   05161 Hepatitis B
    101098235 (NFATC4)
   05163 Human cytomegalovirus infection
    101098235 (NFATC4)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101098235 (NFATC4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101098235 (NFATC4)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101098235 (NFATC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG SAG
Motif
Other DBs
NCBI-GeneID: 101098235
NCBI-ProteinID: XP_023111379
Ensembl: ENSFCAG00000005602
Position
B3
AA seq 901 aa AA seqDB search
MGAASCEDEELEFKLVFGEEKETPPLGAGGSGEELDSEDAPPCCRLALGEPPPYGAAPIG
IPRPPPPRPGMHSPPPRPAPSPGTWESQPARSVRLGGAGGASGGVGGGRVLECPSIRITS
ISPTPDPPATLEDNPDAWGDGSPRDYPPPEGFGGYRETGGQGGGPFFSPSPGSSSLSSWS
FFSDASDEAALYAACDEVESELNEAASRFGLGSPLPSPRASPRPWTPDDPWNLYGPSPGG
RGPEDSWLLLSAPGPTPASPRPASPCGKRRYSSSGTPSSASPALSRRGSLGEEGPEPPPP
PPLPLARDPGSPGPFDYVGAPPAESIPQKTRRTSSEQAVALPRPEEPAPCNGKMQSGAEE
AVAPPGGPRKEVAGMDYLAVPSPLAWSKARIGGHSPIFRTSALPPLDWPLPSQYEQLELR
IEVQPRAHHRAHYETEGSRGAVKAAPGGHPVVKLLGYSEKPLTLQMFIGTADERNLRPHA
FYQVHRITGKMVATASYEAVVSGTKVLEMTLLPENNMAANIDCAGILKLRNSDIELRKGE
TDIGRKNTRVRLVFRVHVPQGSGKVVSVQTASVPIECSQRSAQELPQVEAYSPSACSVRG
GEELVLTGSNFLPDSKVVFIERGPDGKLQWEEEATVNRLQSNEVTLTLTVPEYSNKRVSR
PVQVYFYVSNGRRKRSPTQSFKFLPVIFKEEPLPDSSLRGFPSAPGPPFGTDMDFSPPRP
PYPSYPHEDPAYEAPYLSEGFSYGTPPLYPQTGPPPSYRPGLRMFPETGGTAGCARPPPV
SFLPRPFPSDPYGGRGSPFPLGLPFPPPAPFRPPLPSSPPLEGPFPPQSGVHPPPAEGYN
EVGPSYGPGEGAPEQEKSRGGYGSGFRDSVPIQGITLEEVSEIIGRDLSGFPAPPGEEPP
A
NT seq 2706 nt NT seq  +upstreamnt  +downstreamnt
atgggggcagcgagctgcgaggatgaggagctggaatttaagctggtgttcggggaggaa
aaggagacccccccgctgggcgcgggggggtcgggggaagaactggactcagaggacgcc
ccgccatgctgccgtctggccctgggggagccccctccctatggcgctgcccctattggc
attcctcggcctccaccccctcggcctggcatgcattcgccaccaccccgcccggccccc
tcacctggcacttgggagagccagcccgcccggtcagtgaggctggggggggcgggaggg
gcttccgggggggttgggggaggccgtgttcttgagtgccctagcatccgcatcacctcc
atctctcccacgcccgacccgccggccacgctggaggacaaccctgatgcctggggggac
ggctcccccagggattacccgccaccagaaggctttgggggctaccgagagaccgggggc
cagggcgggggccccttcttcagccccagccctggcagtagcagcctgtcctcgtggagc
ttcttctccgacgcttcagacgaggcagccctgtatgcggcctgcgacgaggtggagtct
gagctaaatgaggcggcctcccgctttggcctgggctcccccctgccctcgcctagggcc
tcccctaggccgtggacccccgacgatccctggaacctgtatggtccgagccccggaggt
cgggggccagaggatagctggctactcctcagcgctcctgggcccaccccagcctccccg
cggcccgcctctccctgtggcaagcggcgctattccagctctgggaccccgtcttcggcc
tccccagctctgtcccgccgcggcagcctgggggaggaggggcccgagccacctccacca
cccccgttgcctctggcccgtgaccctggctcccctggcccttttgactacgtgggagcc
ccaccggcggagagcatcccgcagaagacccggcggacctccagcgagcaggcagtggct
ctgcctcggcctgaggagcctgccccgtgcaatggaaagatgcagtcaggagcagaggag
gctgtggctcctcccgggggtcctcggaaggaggtggcgggcatggactacctggcagtg
ccctccccactggcttggtccaaggcccggattgggggacacagccccatcttcaggacc
tctgccttacccccactggactggcctctgcccagccagtatgagcagctggagctgagg
attgaggtgcagcctagagcccaccaccgggcccattacgagaccgagggcagccgaggg
gctgtcaaagctgcccctggtggtcaccctgtagtcaagctcctaggctacagtgagaag
ccactgaccctacagatgttcattggcactgcagatgaaaggaacctgcggcctcatgcc
ttctatcaggtgcaccgtatcacaggcaagatggtggccacagctagctatgaagctgta
gtcagtggtaccaaagtgttggagatgaccctgcttcctgagaacaacatggcagccaac
attgactgtgctggaatcctgaagctccggaactcagacattgagctgcggaagggggag
acagacattgggcgcaagaacacacgtgtgcggctcgtcttccgggtgcacgtgccccag
ggcagcgggaaggtcgtctcagtgcagacagcatcagtgcccattgagtgctcccagcgc
tcggcccaggagctgccccaggtagaggcctacagccccagtgcctgttctgtgagagga
ggagaggaactagtgctcactggctccaacttcctgccagactccaaggtggtgttcatc
gagaggggccctgatggaaagctgcagtgggaggaggaggccacagtgaaccggttgcag
agcaatgaggtgacgctgaccctgactgtccctgagtacagcaacaagcgggtgtcccgg
ccagtccaggtctacttttatgtctccaatgggcggaggaagcgcagtcctacccagagt
ttcaagttcctgcctgtgatcttcaaggaggagcctttaccggactcctctctccgcggc
ttcccttcagcacctggccccccctttggcactgacatggacttctcaccacccaggccc
ccatacccctcctatccccacgaagaccctgcttacgaagctccttacctgtcagaaggc
ttcagctatggcacaccccctctgtacccccagacggggcccccaccatcctacagacct
ggcctacggatgttccctgagactgggggtaccgcaggttgtgcccgcccgcctccagtc
tccttccttccccggcccttccctagtgacccctatggaggacggggctccccatttccc
ttggggctgccgttccctcctccagccccctttcgacctccactgccttcatccccaccc
ctcgaaggccccttccctccccagagtggtgttcatcccccacctgctgagggatacaat
gaggtagggccgagctatggccctggggagggggctccggagcaggagaaatccaggggt
ggctacggcagcggcttccgagacagtgtccctatccagggtatcacgctggaggaagtg
agtgagatcattggccgagacctgagtggcttccctgcacctcctggagaagagcctcct
gcctga

KEGG   Felis catus (domestic cat): 101101259Help
Entry
101101259         CDS       T02385                                 

Gene name
NFATC1
Definition
(RefSeq) nuclear factor of activated T-cells, cytoplasmic 1 isoform X3
  KO
K04446  nuclear factor of activated T-cells, cytoplasmic 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04218  Cellular senescence
fca04310  Wnt signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04658  Th1 and Th2 cell differentiation
fca04659  Th17 cell differentiation
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04921  Oxytocin signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
fca05321  Inflammatory bowel disease (IBD)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101101259 (NFATC1)
   04310 Wnt signaling pathway
    101101259 (NFATC1)
   04024 cAMP signaling pathway
    101101259 (NFATC1)
   04022 cGMP-PKG signaling pathway
    101101259 (NFATC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101101259 (NFATC1)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101101259 (NFATC1)
   04650 Natural killer cell mediated cytotoxicity
    101101259 (NFATC1)
   04660 T cell receptor signaling pathway
    101101259 (NFATC1)
   04658 Th1 and Th2 cell differentiation
    101101259 (NFATC1)
   04659 Th17 cell differentiation
    101101259 (NFATC1)
   04662 B cell receptor signaling pathway
    101101259 (NFATC1)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101101259 (NFATC1)
  09158 Development
   04380 Osteoclast differentiation
    101101259 (NFATC1)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101101259 (NFATC1)
  09163 Immune disease
   05321 Inflammatory bowel disease (IBD)
    101101259 (NFATC1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101101259 (NFATC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101101259 (NFATC1)
   05170 Human immunodeficiency virus 1 infection
    101101259 (NFATC1)
   05161 Hepatitis B
    101101259 (NFATC1)
   05163 Human cytomegalovirus infection
    101101259 (NFATC1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101101259 (NFATC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101101259 (NFATC1)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) NF-AT
    101101259 (NFATC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer TIG
Motif
Other DBs
NCBI-GeneID: 101101259
NCBI-ProteinID: XP_006939043
Ensembl: ENSFCAG00000000884
UniProt: A0A2I2UJJ5
Position
D3
AA seq 890 aa AA seqDB search
MTGLEEDQEFDFDFLFEFNQSDEGAVAAPEHYSYAPPSIGTALPPGPAHPSLPALCHDLQ
SAAPGMPGAAAGQPPGYGGAVDGGPSGYLLSSSHIRPNGAPALESPRIEITSYMGLHHGN
NQFFHDVEVGDVIPSSKRPPSTATLNLPNLEAYRDPSCLSPASSLSSRSCNSEASSYESN
FSYPYASPQTSPWQSPCVSPKTTDPEEGFPRGLGACGLLGSPRHSPSTSPRTSVTEESWL
GARTSRPSSPCNKRKYGLNGRQLSCSPHHSPTPSPRSSPRVSVTDDTWLGNSTQYTSSAI
VAAINALSTDSTLELGDGVPVKARKTALDRCPSVALKVEPAGEDLGATPPTSEFLPEEVP
PFQHIRKGAFCDQYLSVPQHPYQWARPRSPTSYASPSLPALDWQVPSRSGPYELRIEVQP
KPHHRAHYETEGSRGAVKASAGGHPSVQLHGYLENEPLTLQLFIGTADDRLLRPHAFYQV
HRITGKTVSTTSHEAILSNTKVLEIPLLPENNMRAIVDCAGILKLRNSDIELRKGETDIG
RKNTRVRLVFRVHIPQPNGRTLSLQVASNPIECSQRSAQELPLVEKQSAASCPVLGGKKM
VLSGHNFLQDSKVIFVEKAPDGHHIWEAEAKTDRGLCKPNSLVVEIPPFRNPRITSPVQV
SFYVCNGKRKRSQYQHLTYLPANAPTIKTEPADDHEPALTCGPGGQGLSPLPQPRFSQQL
VVPPDPGSCLVAGFPPCPQRSTVVSPPPGTGQELHDPSSAAYGKGTASQGHGHLGLQRPA
GGVLAVRETPRPVGVHPGPPQQPPPVLLQPQSCSPTRPSEMGRQQHRLPKAPRSESAAPR
PPPLPEVREDSSHSLAPFPVTVKREPQELDQLYLDDVNEIIRNDLSSTNI
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgacggggctggaggaggaccaggagttcgacttcgatttccttttcgagtttaaccag
agcgacgaaggcgcggtcgctgccccagagcactacagttatgcaccccccagcatcggc
accgctctgcctcccggcccggctcacccctcgctgccggctctgtgccacgacctgcag
agtgccgccccgggcatgccgggcgctgcggccggccagcccccgggctacgggggggct
gtggacggcgggccctccggctacctcctgtcctccagccacatccggcccaacggagcc
cccgccctggagagcccccgcatcgagatcacctcgtacatgggactgcaccacggcaac
aaccagttcttccacgatgtggaggtgggagacgtcattcccagctccaagcggcccccc
tcgacggccaccctgaatctgcccaacctggaggcctaccgggacccctcgtgcctgagc
ccggccagcagcctgtcttcccgcagctgcaactctgaggcctcgtcctacgagtccaac
ttttcgtacccctacgcgtccccgcagacgtccccgtggcagtcgccctgcgtgtccccc
aagaccacagaccccgaggagggcttcccccgcggcctgggcgcctgcggcctgctgggg
tcccccagacactcgccctccacttcgccccgcacgagcgtcacggaagagagctggctg
ggggcccgcacgtcccggccgtcgtccccctgcaacaagaggaagtacggtctcaatggc
cggcagctctcctgctccccgcaccactcgcccacgccgtccccgcgcagctcgccgcgg
gtcagcgtcaccgacgacacctggctgggcaacagcacgcagtacaccagctccgccatc
gtggccgccatcaacgccctgagcaccgacagcaccctggagctgggcgacggcgtcccc
gtgaaggcgcgcaagaccgccctggaccgctgtccctcggtggcgctcaaggtggagccg
gccggcgaggacctgggggccacgccgcccacgtctgagttcctgcccgaggaggtcccc
cccttccagcacatccggaagggcgccttctgcgaccagtacctgtcggtgccgcagcac
ccctaccagtgggccaggcccaggtccccgacatcctacgccagcccgtccctccccgcc
ctggactggcaggtgccctcgcgctcggggccctacgagctgcggatcgaggtgcagccc
aagcctcaccacagagcccactacgagacggaggggagccgcggggctgtgaaggcgtcg
gccggaggacaccccagcgtgcagctacacggctacttggagaacgagccgctcacgcta
cagctgttcatcgggaccgctgacgaccgcctgctgagaccccacgccttctaccaggtg
catcggatcacgggcaagaccgtgtccaccaccagtcacgaggccatcctgtccaacacc
aaagtcctggagatcccgctgctgccggagaacaacatgagagccatcgtggactgcgcc
gggatcctgaagctcagaaactcggacatcgagctgcgcaaaggggagacagacatcggg
agaaagaacaccagggtgaggctggtcttccgggtccacatcccgcagcccaacggccgg
acgctgtccctgcaagtggcctcgaaccccatcgagtgctcccagcggtcggcccaggag
ctgcccctcgtggagaagcagagcgcggccagctgccccgtcctcggcgggaagaagatg
gtcctgtccggccataactttctgcaagactccaaggtcattttcgtggagaaagcacca
gacggtcaccacatctgggaggccgaggcaaagacggacagaggcctgtgcaagccgaat
tcgttggtggtcgagataccgcctttccgcaatccgagaataacgagccccgtccaagtc
agtttctacgtctgcaacgggaagaggaagaggagccagtatcagcacttgacctacctt
cctgcgaacgctccaaccataaaaacagagcccgcagacgaccacgagcctgccctgacc
tgtgggccagggggccagggcctgagcccgctcccgcagccgcgcttcagccagcagctc
gtggtgccacccgacccgggctcctgcctggtggccggcttcccgccctgtccgcagaga
agcaccgtggtgtcgccgccacccggcaccggccaggagctccacgacccatcttccgct
gcctacggcaagggcacggccagccagggccacggccaccttggacttcagcggccggcc
ggaggggtgctcgccgttcgggagacgccgaggcctgtgggcgtgcaccccgggcccccc
cagcagccgccccccgtcctgctgcaaccacagtcctgcagccctacccgcccatccgag
atgggccgccagcagcaccgactgccgaaggctccgaggagcgagtctgcagccccccgg
cccccgccgctgcccgaggtgcgtgaggacagtagtcatagtctggctccctttcccgta
acggtcaagcgagagcctcaggagctggaccagctgtacctggacgacgtaaatgagata
atccggaacgatctctccagcaccaacatctga

DBGET integrated database retrieval system