KEGG   Felis catus (domestic cat): 101080547Help
Entry
101080547         CDS       T02385                                 

Gene name
ATP5F1C
Definition
(RefSeq) ATP synthase subunit gamma, mitochondrial isoform X1
  KO
K02136  F-type H+-transporting ATPase subunit gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101080547 (ATP5F1C)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101080547 (ATP5F1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101080547 (ATP5F1C)
   05012 Parkinson disease
    101080547 (ATP5F1C)
   05016 Huntington disease
    101080547 (ATP5F1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt ACT_4
Motif
Other DBs
NCBI-GeneID: 101080547
NCBI-ProteinID: XP_003988137
Ensembl: ENSFCAG00000000196
UniProt: M3VU98
Position
B4
AA seq 298 aa AA seqDB search
MFSRAGVAGLSAWAVQPQWIQVRNMATLKDITRRLKSIKNIQKITKSMKMVAAAKYARAE
RELKPARVYGVGSLALYEKADIKAPEDKKKHLLIGVSSDRGLCGAIHSSVAKQMKNEVAT
LTAAGKEVMLVGIGDKIRGILHRTHSDQFLVSFKEVGRKPPTFGDASVIALELLNSGYEF
DEGSIIFNRFRSVISYKTEEKPIFSLDTVASAESMSVYDDIDADVLRNYQEYALANIIYY
SLKESTTSEQSARMTAMDNASKNASEMIDKLTLTFNRTRQAVITKELIEIISGAAALD
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgttctctcgggcgggcgtcgcggggctctcggcctgggccgtgcagccgcaatggatc
caagttcgaaatatggcaacattaaaagatattaccagacggctaaagtcgatcaaaaac
atccagaaaattaccaagtctatgaaaatggtggcagcagcaaaatacgcccgagccgag
agggagctgaaaccagcacgagtgtatggagtaggatctttggctctgtatgagaaagct
gatattaaggcgcctgaagacaagaagaaacacctcctaattggcgtgtcctctgatcga
gggctctgtggtgctattcattcctcggttgccaaacagatgaaaaatgaggtggccaca
ctcacggcagccgggaaagaagttatgcttgttggaattggtgataaaatcaggggtata
cttcataggactcactctgaccagtttctggtgtccttcaaagaagtgggaagaaaacct
cctacttttggagatgcgtctgtcattgcccttgaactactaaattccggatatgaattt
gatgaagggtctatcatctttaaccggttcaggtctgtcatctcctacaagacagaagaa
aagcccatcttttccctggataccgttgcaagtgccgagagcatgagtgtctatgatgat
attgatgctgacgtgctacgcaattaccaagaatacgccttggccaacatcatctactat
tctctaaaggagtccaccacgagtgagcagagtgcgaggatgacggccatggacaacgcc
agcaagaatgcctcggagatgattgacaaactgactttgacattcaaccgcacccgccag
gctgtcatcacgaaggagctgatcgaaatcatctccggcgccgcggctctggattaa

KEGG   Felis catus (domestic cat): 101085528Help
Entry
101085528         CDS       T02385                                 

Gene name
ATP5F1D
Definition
(RefSeq) ATP synthase subunit delta, mitochondrial
  KO
K02134  F-type H+-transporting ATPase subunit delta
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101085528 (ATP5F1D)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101085528 (ATP5F1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085528 (ATP5F1D)
   05012 Parkinson disease
    101085528 (ATP5F1D)
   05016 Huntington disease
    101085528 (ATP5F1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_DE_N DUF4175
Motif
Other DBs
NCBI-GeneID: 101085528
NCBI-ProteinID: XP_003981655
Position
A2
AA seq 168 aa AA seqDB search
MLPVAVLRRPGLRCLVRQARAYAEAAAAPAPAAGPGQMSFTFASPTQVFFNGANVRQVDV
PTQTGAFGILAAHVPTLQVLRPGLVVVHAEDGTTSKYFVSSGSVTVNADSSVQLLAEEAV
TLDMLDVGAAKVNLEKAQSELSGAADEASRAEIQIRIEANEALVKALE
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atgctgcccgtcgcggtcctgcgccgtcccggcctgcgctgcctcgtccgtcaggcccgc
gcctacgctgaggctgcggctgcgccggccccggctgcgggcccgggccagatgtccttc
accttcgcctcacccacgcaggtatttttcaatggtgccaacgtccggcaagtggacgtt
cccacgcagacgggagcctttggcatcctggcggcccacgtacccaccttgcaggtgctg
cggccggggctggttgttgtccacgccgaggacggcaccacctccaaatactttgtgagt
agcggctccgtcacagtgaacgctgattcctcagtgcagctgttggctgaagaggccgtg
accttggacatgctggacgtgggggccgccaaggtgaacttggagaaggcgcagtcggag
ctgtcaggggcagcagacgaggcctccagggccgagatccaaatccgcatcgaggccaac
gaggccctggtgaaagctctcgagtag

KEGG   Felis catus (domestic cat): 101087245Help
Entry
101087245         CDS       T02385                                 

Gene name
ATP5F1B
Definition
(RefSeq) ATP synthase subunit beta, mitochondrial
  KO
K02133  F-type H+-transporting ATPase subunit beta [EC:7.1.2.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101087245 (ATP5F1B)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101087245 (ATP5F1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087245 (ATP5F1B)
   05012 Parkinson disease
    101087245 (ATP5F1B)
   05016 Huntington disease
    101087245 (ATP5F1B)
Enzymes [BR:fca01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     101087245 (ATP5F1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N ATPase_2 NB-ARC RsgA_GTPase ATPase AAA_19 AAA_16 ABC_tran DUF2075
Motif
Other DBs
NCBI-GeneID: 101087245
NCBI-ProteinID: XP_003988964
Ensembl: ENSFCAG00000012030
Position
B4
AA seq 528 aa AA seqDB search
MLGFVGRVAATSASGALRGLSSSAPLPQAQVLLRATPAVLQPARDYAAQTSPSPKAGAAT
GRIVAVIGAVVDVQFDEGLPPILNALEVQGRDTRLVLEVAQHLGESTVRTIAMDGTEGLV
RGQKVLDSGAPIKIPVGPETLGRIMNVIGEPIDERGPIKTKQFAAIHAEAPEFMEMSVEQ
EILVTGIKVVDLLAPYAKGGKIGLFGGAGVGKTVLIMELINNVAKAHGGYSVFAGVGERT
REGNDLYHEMIESGVINLKDATSKVALVYGQMNEPPGARARVALTGLTVAEYFRDQEGQD
VLLFIDNIFRFTQAGSEVSALLGRIPSAVGYQPTLATDMGTMQERITTTKKGSITSVQAI
YVPADDLTDPAPATTFAHLDATTVLSRAIAELGIYPAVDPLDSTSRIMDPNIVGNEHYDV
ARGVQKILQDYKSLQDIIAILGMDELSEEDKLTVSRARKIQRFLSQPFQVAEVFTGHMGK
LVPLKETIKGFQQILAGEYDHLPEQAFYMVGPIEEAVAKADKLAEEHS
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttgggtttcgtgggccgtgtggccgctacctcggcctccggggccttgcggggactc
agctcttcagcgccgctaccccaagcccaggtcttactgcgggccaccccggcggtgctc
cagcctgctagagactatgccgcccaaacatctccttcgccgaaggcaggcgctgccacc
gggcgcatcgtggcagtcatcggtgctgtggtggatgtccagtttgatgagggactacca
cccatcctaaatgccctagaagtgcaaggcagggacaccagactggttttggaggtggct
cagcatttgggtgagagcacggtaaggactattgccatggatggtacagaaggcttggtt
aggggccagaaagtcctggattctggtgcaccaatcaaaattcctgttggtcctgagacc
ttgggcagaatcatgaatgtcattggagaacctattgatgagagaggtcccatcaaaacc
aaacaatttgcagctattcatgctgaggctcctgagttcatggagatgagtgttgagcag
gaaattctggttactggtatcaaggttgtggatctgctggctccctatgccaagggtggc
aaaattgggctgtttggtggtgctggagttggcaagactgtactgatcatggagttaatc
aacaatgtggccaaagcccatggtggttactctgtgtttgctggtgttggtgagaggacc
cgtgaaggcaatgacttataccatgaaatgattgagtctggtgttatcaacttaaaagat
gctacctccaaggtagcgctagtgtatggtcaaatgaatgaaccacctggtgctcgcgcc
cgggtagctctgactggactgacggttgctgaatacttcagagaccaagagggtcaagat
gtactgctctttatcgataacatctttcgtttcacccaggctggctctgaggtgtctgct
ctattgggtagaatcccttctgcggtgggctatcagcctaccctggccactgacatgggt
accatgcaggaaagaatcaccaccaccaagaagggatctattacctctgtgcaggctatc
tatgtgcctgctgatgacttgacggaccctgcccctgccactacctttgcccatttggat
gctaccactgtgctgtcccgtgctattgctgagttgggcatctatccagctgtggatcct
ctggattccacctctcgaattatggatcccaacattgttggaaatgagcattatgatgtt
gcccgtggggtacaaaagatcctacaggactacaaatctctccaggacatcattgcaatc
ctgggtatggatgaactttctgaggaagacaagttgactgtgtcccgtgcacggaaaata
cagcgtttcttgtctcagccattccaggttgctgaggttttcacaggtcatatggggaag
ctggtacctctgaaggagaccatcaaaggtttccagcagattttggcaggtgaatatgac
catctcccagaacaggccttctatatggtgggacccattgaggaagctgtggcaaaagct
gataagctggctgaagagcattcgtga

KEGG   Felis catus (domestic cat): 101087259Help
Entry
101087259         CDS       T02385                                 

Gene name
ATP5PO
Definition
(RefSeq) ATP synthase subunit O, mitochondrial
  KO
K02137  F-type H+-transporting ATPase subunit O
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101087259 (ATP5PO)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101087259 (ATP5PO)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087259 (ATP5PO)
   05012 Parkinson disease
    101087259 (ATP5PO)
   05016 Huntington disease
    101087259 (ATP5PO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: OSCP
Motif
Other DBs
NCBI-GeneID: 101087259
NCBI-ProteinID: XP_003991504
Ensembl: ENSFCAG00000028656
UniProt: M3WSZ4
Position
C2
AA seq 213 aa AA seqDB search
MASSAVSGLSRQVRCFSTSVVRPFAKLVRPPVQIYGIEGRYATALYSAASKQNKLEQVEK
ELLRVAQILKEPKMAASIMNPYVKRSVKVKSLNDMTAKERFSPLTCNLINLLAENGRLNN
TPGVVSAFSTMMSVHRGEVPCTVTTASPLDEPTLAELRTVLKSFLSKGQVLKLEVKIDPS
IMGGMIVRIGEKYADMSAKTKIQKLSRAMREIF
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgtctgcagtgtccgggctctcccggcaggtgcgatgctttagtacatctgtg
gtcaggccatttgccaagctcgtgaggccacctgttcagatatatggtatcgaaggtcgc
tatgccactgctctttattctgctgcatctaaacagaataagctggaacaagtcgaaaag
gaattgttgagagtagcgcaaatcttgaaggaacccaaaatggctgcttccattatgaat
ccctatgtgaagcgttctgtgaaagtgaaaagcctaaacgacatgacagcaaaagagagg
ttctctcccctcacatgcaacctgatcaatttgcttgctgaaaatggtcgcttgaacaac
acccctggagtcgtttctgccttttcgaccatgatgagtgtccaccgtggagaagttcct
tgcacagtgaccactgcatcccctttagatgaacccactcttgctgaattaagaacagtc
ctgaagagcttcctaagtaaaggccaagtattgaaattggaggttaagattgatccgtcc
atcatgggtggaatgattgtccgtattggagagaaatatgctgatatgtctgcgaaaacc
aagattcagaagctgagcagggccatgcgggagattttctga

KEGG   Felis catus (domestic cat): 101097006Help
Entry
101097006         CDS       T02385                                 

Gene name
ATP5PB
Definition
(RefSeq) ATP synthase F(0) complex subunit B1, mitochondrial
  KO
K02127  F-type H+-transporting ATPase subunit b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101097006 (ATP5PB)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101097006 (ATP5PB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097006 (ATP5PB)
   05012 Parkinson disease
    101097006 (ATP5PB)
   05016 Huntington disease
    101097006 (ATP5PB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mt_ATP-synt_B DUF2105 TraQ
Motif
Other DBs
NCBI-GeneID: 101097006
NCBI-ProteinID: XP_011283367
Ensembl: ENSFCAG00000028321
UniProt: M3WUE9
Position
C1
AA seq 256 aa AA seqDB search
MLSRVVLSAAAAAAPRLKNAAFLGPGVLQATRIFHTGQPSLAPVPPLPEYGGKVRFGLIP
EEFFQFLYPKTGVTGPYVLGTGLILYFLSKEIYVITAETFTAVSTIGLLIYIIKKYGASV
GEFADKLNEQKIAQLEEVKQASIKQIQDAIDMEKSQQALVQKRHYLFDVQRNNIAMALEL
TYRERLHRVYKEVKNRLDYHISVQNMMRRKEQEHMINWVEKHVVQSISAQQEKETIAKCI
ADLKLLAKKAQAQPVL
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgctgtcccgggtggtgctttctgcggccgctgcagcggccccccgtctgaagaacgca
gccttcctcggtccaggggtattgcaggcaacaaggatctttcacacagggcaaccaagc
cttgcccctgtaccacctcttcctgaatatggaggaaaagttcgttttgggctgatcccc
gaggagttcttccagttcctttatcccaaaactggcgtaacaggaccctatgtgcttgga
actgggcttatcttatattttctgtccaaagaaatatatgtgatcactgcagagaccttt
actgccgtatcaacaataggattgcttatctatataattaaaaaatatggtgcctctgtt
ggagaatttgctgataaactcaatgagcaaaaaattgcccaactagaagaggtgaaacag
gcttccatcaagcagatccaggatgcaattgatatggaaaagtcacagcaagcactggtt
caaaagcgccattacctttttgatgtccagaggaataacattgctatggcactggaactt
acttaccgggaacggctgcatagagtatacaaggaggtaaagaatcgcctggactatcac
atctctgtgcagaacatgatgcgtcgaaaggaacaagagcacatgataaactgggtggag
aagcatgtggtgcagagcatctctgcacagcaggagaaggagacaattgccaagtgcatt
gcagatctgaagctccttgcaaagaaggctcaagcacagccagttttgtaa

KEGG   Felis catus (domestic cat): 101097080Help
Entry
101097080         CDS       T02385                                 

Gene name
ATP5MC3
Definition
(RefSeq) ATP synthase F(0) complex subunit C3, mitochondrial
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101097080 (ATP5MC3)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101097080 (ATP5MC3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097080 (ATP5MC3)
   05012 Parkinson disease
    101097080 (ATP5MC3)
   05016 Huntington disease
    101097080 (ATP5MC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_C TM1506
Motif
Other DBs
NCBI-GeneID: 101097080
NCBI-ProteinID: XP_003990933
Ensembl: ENSFCAG00000012719
UniProt: M3WHG2
Position
C1
AA seq 141 aa AA seqDB search
MFACAKLACTPALIRAGSRVAYRPISASVLSRPETRTEEGSTVFNGSRTGVSHLIQREFQ
TSAVSRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGF
ALSEAMGLFCLMVAFLILFAM
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atgttcgcctgcgccaagctcgcctgcacccccgctctgatccgagctggatccagagtt
gcatacagaccaatttctgcatcagtgttatctcgaccagagactaggactgaagagggc
tctacggtatttaatgggtccaggactggtgtgtcccacctaatccaaagggagtttcag
accagtgcagtcagcagagatatcgatactgctgccaaatttattggtgcaggtgctgcc
actgtgggagtggctggttctggtgctggtattggaacagtctttggcagccttatcatt
ggttatgccagaaatccttcgctgaagcagcagctgttctcatatgctatcctgggattt
gccttgtctgaagctatgggtctcttttgtttgatggttgctttcttgattttgtttgcc
atgtaa

KEGG   Felis catus (domestic cat): 101097110Help
Entry
101097110         CDS       T02385                                 

Gene name
ATP5MC1
Definition
(RefSeq) ATP synthase F(0) complex subunit C1, mitochondrial
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101097110 (ATP5MC1)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101097110 (ATP5MC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097110 (ATP5MC1)
   05012 Parkinson disease
    101097110 (ATP5MC1)
   05016 Huntington disease
    101097110 (ATP5MC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_C
Motif
Other DBs
NCBI-GeneID: 101097110
NCBI-ProteinID: XP_003996770
Ensembl: ENSFCAG00000002344
UniProt: M3VYC7
Position
E1
AA seq 136 aa AA seqDB search
MQTTGALLIPSALIRCCTRDLIRPVSASFLSRSEIPSKQPSYRSSPLQVARREFQTSVVS
RDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIGYARNPSLKQQLFSYAILGFALSEA
MGLFCLMVAFLILFAM
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atgcagaccaccggggcactactcattccttctgctctgatccgctgttgtaccagggat
ctcatccggcctgtgtctgcatccttcttgagtaggtcagagatcccatctaaacagcca
tcctaccgcagctccccgctccaggtggcccggcgggagttccagaccagtgtcgtctcc
cgggacattgacacagcagccaagtttattggcgccggggctgccacagttggtgtggct
ggctcaggggctggcatcggaacagtgtttggcagcctgatcattggctatgccaggaac
ccgtctctcaagcagcaactcttctcctatgccattctgggctttgccctgtctgaggcc
atggggctcttctgtttgatggtcgccttcctcatcctcttcgccatgtga

KEGG   Felis catus (domestic cat): 101097436Help
Entry
101097436         CDS       T02385                                 

Gene name
ATP5PD
Definition
(RefSeq) ATP synthase subunit d, mitochondrial
  KO
K02138  F-type H+-transporting ATPase subunit d
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101097436 (ATP5PD)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101097436 (ATP5PD)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097436 (ATP5PD)
   05012 Parkinson disease
    101097436 (ATP5PD)
   05016 Huntington disease
    101097436 (ATP5PD)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mt_ATP-synt_D DUF2045
Motif
Other DBs
NCBI-GeneID: 101097436
NCBI-ProteinID: XP_003997187
Ensembl: ENSFCAG00000022888
UniProt: M3XC82
Position
E1
AA seq 161 aa AA seqDB search
MAGRKLALKAIDWVAFGEIIPRNQKAIANSLKSWNETLTSRLATLPENPPAIDWAYYRAN
VAKAGLVDDFEKKFNALKVPVPEDKYTVQVDAEEREDVKSCAEFLSLSKARIVEYEKELE
KMKNIIPFDQMTIEDLNEVFPETKLDKKKYPYWPHKPIENL
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atggctgggcgaaaacttgctctaaaagccattgactgggtagcttttggggagatcata
ccccgaaaccagaaggccattgctaactccctgaaatcctggaatgagactctcacctcc
aggttggcaactctccctgagaatccacctgctatcgactgggcttactacagggccaat
gtggcgaaggctggcttggtagatgactttgagaagaagtttaatgccctgaaggttcct
gtgccagaagataaatatactgtccaggtggatgctgaagaaagagaagatgtgaaaagt
tgtgctgagtttttgtctctctcaaaggccaggattgtggaatatgaaaaagagctggag
aagatgaagaatataattccatttgatcagatgaccattgaggacctgaatgaagtcttc
ccagaaaccaaattagacaaaaagaagtatccctactggcctcacaagccaattgaaaat
ttataa

KEGG   Felis catus (domestic cat): 101099742Help
Entry
101099742         CDS       T02385                                 

Gene name
ATP5PF
Definition
(RefSeq) ATP synthase-coupling factor 6, mitochondrial
  KO
K02131  F-type H+-transporting ATPase subunit 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101099742 (ATP5PF)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101099742 (ATP5PF)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101099742 (ATP5PF)
   05012 Parkinson disease
    101099742 (ATP5PF)
   05016 Huntington disease
    101099742 (ATP5PF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_F6 RICH
Motif
Other DBs
NCBI-GeneID: 101099742
NCBI-ProteinID: XP_006936011
Ensembl: ENSFCAG00000029970
UniProt: M3WTV2
Position
C2
AA seq 108 aa AA seqDB search
MILQRLFRVSSLMRSMVSVHLRRNIGVTAVAFNKELDPVQKLFVDKIREYKTKRQASGGP
VDTGPEYQQELERELFKLKQMYGKADMNTFPNFNFEDPKFEVIDKPQS
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgattctccagaggctcttcagggtctcctctctcatgcggtccatggtctcagtgcat
ctgaggaggaacatcggtgttacagcagtggcatttaataaggaacttgatcctgtacag
aaactcttcgtggataagattagagaatacaaaactaagcgacaggcatccggaggacct
gttgatactggcccagagtatcagcaagagctggagagagagctttttaagcttaagcaa
atgtatggtaaagcagacatgaatactttccctaacttcaattttgaagatcccaaattt
gaagtcatcgacaaaccccagtcctga

KEGG   Felis catus (domestic cat): 101100487Help
Entry
101100487         CDS       T02385                                 

Gene name
ATP5MC2
Definition
(RefSeq) ATP synthase F(0) complex subunit C2, mitochondrial isoform X2
  KO
K02128  F-type H+-transporting ATPase subunit c
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101100487 (ATP5MC2)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101100487 (ATP5MC2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101100487 (ATP5MC2)
   05012 Parkinson disease
    101100487 (ATP5MC2)
   05016 Huntington disease
    101100487 (ATP5MC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_C
Motif
Other DBs
NCBI-GeneID: 101100487
NCBI-ProteinID: XP_006933817
Position
B4
AA seq 220 aa AA seqDB search
MGGGTGGVSGDFRGDPGRPGFPLCSQHLTPCLAPIEERLVGSGRACAEPSFRSSRPPPAP
LCLLCTGSSSPATAPHPLKMYTCAKFVSSPFLVRSTSQLLSRSLSAVALKPPETLTDESL
SSWAAPRPLTSLIPSRGFQTSAASRDIDTAAKFIGAGAATVGVAGSGAGIGTVFGSLIIG
YARNPSLKQQLFSYAILGFALSEAMGLFCLMVAFLILFAM
NT seq 663 nt NT seq  +upstreamnt  +downstreamnt
atgggcggggggacggggggggtgtctggggacttcaggggagatcctggccggcccggc
ttccctctctgctcgcagcatctgacaccgtgcctggcaccaattgaagaacgactcgtt
ggttcaggccgcgcctgcgccgagccttcctttcgctcttcccgccctccccccgcccct
ctctgtcttctgtgcactgggagcagctctcctgccacagcccctcatcccctgaaaatg
tatacgtgtgcaaagttcgtctcctcccccttcttggtcaggagcacctctcagctgttg
agccgatcactgtctgcagtggcactaaaaccaccagagacactgacagatgagagcctc
agcagctgggcagccccacgtcccctgacctcacttattcctagccgcggtttccaaacc
agcgctgcttcaagggacatcgacacagcagccaagttcattggggctggggctgccaca
gttggggtggctggttctggggctggaattgggactgtgtttgggagcctcatcattggt
tatgccaggaacccctctctgaagcagcagctcttctcctacgccattctgggctttgcc
ctctcggaggccatggggctattttgcctgatggtggcctttctcatcctcttcgccatg
tga

KEGG   Felis catus (domestic cat): 101101674Help
Entry
101101674         CDS       T02385                                 

Gene name
ATP5F1A
Definition
(RefSeq) ATP synthase subunit alpha, mitochondrial
  KO
K02132  F-type H+-transporting ATPase subunit alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101101674 (ATP5F1A)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    101101674 (ATP5F1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101674 (ATP5F1A)
   05012 Parkinson disease
    101101674 (ATP5F1A)
   05016 Huntington disease
    101101674 (ATP5F1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_C ATP-synt_ab_N DUF4142
Motif
Other DBs
NCBI-GeneID: 101101674
NCBI-ProteinID: XP_003995204
Ensembl: ENSFCAG00000025952
UniProt: M3WZB0
Position
D3
AA seq 553 aa AA seqDB search
MLSVRVAAAVARALPRRAGLVSKNALGSSFIAARNLHASNTRLQKTGTAEVSSILEERIL
GADTSVDLEETGRVLSIGDGIARVHGLRNVQAEEMVEFSSGLKGMSLNLEPDNVGVVVFG
NDKLIKEGDIVKRTGAIVDVPVGEELLGRVVDALGNAIDGKGPIGSKTRRRVGLKAPGII
PRISVREPMQTGIKAVDSLVPIGRGQRELIIGDRQTGKTSIAIDTIINQKRFNDGTDEKK
KLYCIYVAIGQKRSTVAQLVKRLTDADAMKYTIVVSATASDAAPLQYLAPYSGCSMGEYF
RDNGKHALIIYDDLSKQAVAYRQMSLLLRRPPGREAYPGDVFYLHSRLLERAAKMNDSFG
GGSLTALPVIETQAGDVSAYIPTNVISITDGQIFLETELFYKGIRPAINVGLSVSRVGSA
AQTRAMKQVAGTMKLELAQYREVAAFAQFGSDLDAATQQLLSRGVRLTELLKQGQYSPMA
IEEQVAVIYAGVRGYLDKLEPSKITKFEHAFLAHVISQHQALLGNIRTDGKISEQSDAKL
KEIVTNFLAGFEA
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgctgtccgtgcgcgtcgctgcggccgtggcccgcgccctgcctaggcgggccgggctg
gtctccaaaaatgctttgggatcatccttcattgctgcaaggaacctccatgcctctaac
acacgtctccagaagactggcactgccgaagtgtcctctatccttgaagaacgcattctt
ggagccgatacctctgttgaccttgaggagaccgggcgtgtcctaagcattggtgatggt
attgcccgtgtacatgggctgagaaatgttcaggcagaagaaatggtggagttttcttca
ggtttaaagggtatgtctctgaacttggaacctgacaatgttggtgttgtcgtgtttggc
aatgataaactgattaaagaaggagatattgtgaagagaacaggagccattgtggatgtt
ccagttggtgaggagctgttgggccgtgtcgtagatgcccttggtaatgccattgatgga
aagggtccgattggttccaagacccgtaggcgagttggcctgaaagcccctgggatcatt
cctcgaatttctgtgcgtgagccaatgcagactggcattaaggctgtggatagcttggtg
ccaattggtcgtggtcagcgtgagctgattattggtgaccgtcagactggcaaaacctca
attgctattgacacaatcattaaccagaaacgtttcaacgatggaactgatgaaaagaag
aagctatactgtatctacgttgctattggtcagaagaggtccactgttgcccagttggtg
aagagacttacagatgcagatgccatgaagtacaccatcgtggtttcagctactgcttct
gatgctgctccgcttcagtacctggctccttattctggctgttctatgggagagtatttt
cgggataatggcaaacatgctctgatcatctatgacgacttatccaaacaggctgttgct
tatcgtcagatgtctctgctgctccgccgaccccctggtcgtgaggcctatcctggtgat
gtgttctacctacactctcgtctgctagaaagagcggcgaaaatgaacgattcttttggc
ggtggctccttgactgctttaccagtcatagaaacacaagctggtgatgtgtctgcttac
attccaacaaatgtcatttccatcactgatggacagatcttcttggaaacagaattgttc
tacaaaggtatccgccctgccattaacgttggtttgtctgtgtcccgtgtcggatctgct
gctcaaaccagggccatgaagcaggtggcaggtaccatgaagctggaattggctcagtat
cgtgaggttgctgcttttgcccagttcggttctgaccttgacgctgccacgcaacaactc
ttgagtcgtggcgtgcgattgactgagttgctgaagcaaggacagtattctcccatggct
attgaagaacaagtggctgttatttatgctggtgtgagagggtatcttgataaattggag
cctagcaagatcacaaagtttgagcatgctttcttggctcatgttatcagccagcaccaa
gctctgttgggcaacatcaggactgatggaaagatctcagaacagtcagatgcaaagctg
aaagagattgtgacaaatttcttggctggatttgaagcttaa

KEGG   Felis catus (domestic cat): 105260413Help
Entry
105260413         CDS       T02385                                 

Gene name
ATP5F1E
Definition
(RefSeq) ATP synthase subunit epsilon, mitochondrial
  KO
K02135  F-type H+-transporting ATPase subunit epsilon
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105260413 (ATP5F1E)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    105260413 (ATP5F1E)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105260413 (ATP5F1E)
   05012 Parkinson disease
    105260413 (ATP5F1E)
   05016 Huntington disease
    105260413 (ATP5F1E)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_Eps
Motif
Other DBs
NCBI-GeneID: 105260413
NCBI-ProteinID: XP_023106826
Position
A3
AA seq 51 aa AA seqDB search
MVAYWRQAGLSYIRYSQICAKAVRDALKTEFKANAEKTSGSTVKIVKVKKE
NT seq 156 nt NT seq  +upstreamnt  +downstreamnt
atggtggcgtactggcgacaggctggactcagctacatccgatactcccagatttgtgca
aaagcagtgagagatgcgctgaagacagaattcaaagcaaatgccgagaagacttctggc
agcaccgtaaaaattgtgaaagtgaagaaggagtaa

KEGG   Felis catus (domestic cat): 807932Help
Entry
807932            CDS       T02385                                 

Gene name
ATP6
Definition
(RefSeq) ATP synthase F0 subunit 6
  KO
K02126  F-type H+-transporting ATPase subunit a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807932 (ATP6)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    807932 (ATP6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    807932 (ATP6)
   05012 Parkinson disease
    807932 (ATP6)
   05016 Huntington disease
    807932 (ATP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    807932 (ATP6)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    807932 (ATP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_A
Motif
Other DBs
NCBI-GeneID: 807932
NCBI-ProteinID: NP_008256
UniProt: P48894
Position
MT
AA seq 226 aa AA seqDB search
MNENLFASFTTPTMMGLPIVILIIMFPSILFPSPNRLINNRLVSLQQWLVQLTSKQMLAI
HNHKGQTWALMLMSLILFIGSTNLLGLLPHSFTPTTQLSMNLGMAIPLWAGTVITGFRHK
TKASLAHFLPQGTPVPLIPMLVVIETISLFIQPMALAVRLTANITAGHLLMHLIGGAALA
LMNISTSIALITFTILILLTILEFAVALIQAYVFTLLVSLYLHDNT
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgaacgaaaatctattcgcctctttcactaccccaacaataataggattacctattgtt
attttaattattatatttccaagcattttattcccttcacctaaccgactaattaataac
cgtctagtttcactccaacaatgactagtacaactaacatcaaaacaaatactggctatt
cataatcataaaggacaaacctgagccctaatactaatgtccctaattctatttattggg
tcaacaaacttattaggcctattaccccactcattcaccccaactacccaattatcaata
aatttaggaatagctatcccgctatgagccggcactgtaattaccgggtttcgccacaag
actaaagcatctctggcccactttctaccacaaggaacacctgtccccctaattcctatg
cttgtagtcattgagactatcagcctctttatccaacctatagctctcgccgtacgactt
acagccaacatcaccgcaggtcacttattaatacatctaattggaggggccgccctagcc
ctgataaacattagcacctctattgccttaatcacctttaccattctcattttactaaca
atccttgaatttgccgtagccctaatccaagcctatgtttttaccctgctagtaagccta
tacttacatgataacacctaa

KEGG   Felis catus (domestic cat): 807940Help
Entry
807940            CDS       T02385                                 

Gene name
ATP8
Definition
(RefSeq) ATP synthase F0 subunit 8
  KO
K02125  F-type H+-transporting ATPase subunit 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00158  F-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807940 (ATP8)
 09150 Organismal Systems
  09159 Environmental adaptation
   04714 Thermogenesis
    807940 (ATP8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    807940 (ATP8)
   05012 Parkinson disease
    807940 (ATP8)
   05016 Huntington disease
    807940 (ATP8)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    807940 (ATP8)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   F-type ATPase
    807940 (ATP8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_8 REV
Motif
Other DBs
NCBI-GeneID: 807940
NCBI-ProteinID: NP_008255
UniProt: P48896
Position
MT
AA seq 67 aa AA seqDB search
MPQLDTSTWSITIMSMIMTLFIVFQLKISKYLYPSNPEPKSMTTLKQRNPWEKKWTKIYS
PLSLPQQ
NT seq 204 nt NT seq  +upstreamnt  +downstreamnt
atgccacaactagatacatccacctgatccatcactattatatcaataattataacacta
tttattgtattccaactaaaaatctcaaaatacttatatccatcaaacccagaacctaaa
tccataaccacactaaaacaacggaatccctgagaaaaaaaatgaacgaaaatctattcg
cctctttcactaccccaacaataa

DBGET integrated database retrieval system