KEGG   Felis catus (domestic cat): 101080578Help
Entry
101080578         CDS       T02385                                 

Gene name
NFKB2
Definition
(RefSeq) nuclear factor NF-kappa-B p100 subunit isoform X1
  KO
K04469  nuclear factor of kappa light polypeptide gene enhancer in B-cells 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca05134  Legionellosis
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05224  Breast cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101080578 (NFKB2)
   04064 NF-kappa B signaling pathway
    101080578 (NFKB2)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101080578 (NFKB2)
  09158 Development
   04380 Osteoclast differentiation
    101080578 (NFKB2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101080578 (NFKB2)
   05203 Viral carcinogenesis
    101080578 (NFKB2)
  09162 Cancer: specific types
   05224 Breast cancer
    101080578 (NFKB2)
  09171 Infectious disease: bacterial
   05134 Legionellosis
    101080578 (NFKB2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101080578 (NFKB2)
   05169 Epstein-Barr virus infection
    101080578 (NFKB2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101080578 (NFKB2)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101080578 (NFKB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RHD_DNA_bind RHD_dimer Ank_2 Ank Ank_3 Ank_5 Ank_4 Death
Motif
Other DBs
NCBI-GeneID: 101080578
NCBI-ProteinID: XP_006938193
Ensembl: ENSFCAG00000001242
Position
D2
AA seq 895 aa AA seqDB search
MESCYDPGLDGMIEYDDFKFDPSIVEPKEPAPETADGPYLVIVEQPKQRGFRFRYGCEGP
SHGGLPGASSEKGRKTYPTVKICNYEGPAKIEVDLVTHSDPPRAHAHSLVGKQCSELGVC
AVSVGPKDMTAQFNNLGVLHVTKKNMMEIMIQKLQRQRLRSRPQGLTEAERRELEQEAKE
LKKVMDLSIVRLRFSAFLRASDGSFSLPLKPVISQPIHDSKSPGASNLKISRMDKTAGSV
RGGDEVYLLCDKVQKDDIEVRFYEDDENGWQAFGDFSPTDVHKQYAIVFRTPPYHKMKIE
RPVTVFLQLKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKALPTFSQHFGGGSHMGGGS
GGSAGGYGGAGGGGGSLGFFPSSLAYSPYPSGSAPMGCYPGGGGGAQMAAEAPGVDAGEE
AAEPSASPLTPQRELLQRAREYNARLFGLAQRSARALLDYGVTADARALLAGQRHLLTAQ
DENGDTPLHLAIIHGQTSVIEQIAHVIYHARHLGVVNLTNHLHQTPLHLAVITGQTGVVS
FLLQVGADPALLDRHGDSAVHLALRAGASAPELLRVLLRSGVPAVPQLLHMPDFEGLYPV
HLAVRARSPECLDLLVDSGAEVEAAERQGGRTALHLATEMEELGLVTHLVTKLRANVNAR
TFAGNTPLHLAAGLGSPTLTRLLLKAGADIHAENEEPLCPLPSPPTSGSDSDSEGPERDT
RGSFRGHTPLDLTRSTKVKTLLLNAAQDTTAPPLTPPSPAGPELPLEDTVLQNLEHLLDG
PGAQGSWAELAERLGLRSLVDTYRKTASPSGSLLRSYKLAGGDLAGLLDALSEMGLEEGV
KLLRGPEARDKLPSTEVKEDSAYGSQSVEQETEKLGSPPEPPGGLCHGHPQPQVH
NT seq 2688 nt NT seq  +upstreamnt  +downstreamnt
atggaaagttgctacgacccaggtctggatggcatgattgaatatgatgatttcaaattc
gacccatccattgtggagcccaaggagccagccccagagacagctgatggcccctacctg
gtaatagtggagcagcctaaacagcgtggcttccgatttcgatatggctgtgaaggcccc
tcccatggaggattgccaggtgcctccagtgagaagggccggaagacttatcccacagtc
aagatctgtaactacgagggaccagccaagatcgaggtggacctggtaacgcacagtgac
ccgcctcgtgctcatgcccacagcctggtgggcaagcaatgctcggagctgggggtctgc
gccgtgtctgtggggcccaaggacatgactgcccaatttaacaacctgggcgtcctgcat
gtgaccaagaagaacatgatggagattatgatacaaaaacttcagaggcagcgactccgc
tccaggccccagggccttacggaggccgagcggcgggagctggagcaggaggctaaggag
ctgaagaaggtgatggacctgagcattgtgaggctgcgcttctctgccttccttcgagcc
agtgatggctccttctccctgcccctgaagccagtcatttcccagcccatccacgacagc
aagtctcctggggcctcaaacctgaagatttctcgaatggacaagacagctggctctgtg
cggggtggagatgaggtttatctgctttgtgacaaggtgcagaaagatgacattgaggtt
cggttctacgaggatgatgagaatggatggcaggcctttggggatttctctcccacagat
gttcataaacagtatgccattgtgttccggacaccaccctatcacaagatgaagattgag
cgtcctgtaaccgtgttcctgcaactgaaacgcaagcgtgggggggatgtctcggactcc
aaacagttcacctattaccctctggtggaagacaaggaagaggtgcagcggaagcgaagg
aaagccttgcccaccttctcccagcacttcgggggtggctcccacatgggtggaggctct
gggggctcagccggaggttatggaggagctggaggaggaggtggcagcctcggctttttc
ccctcctccttggcctatagcccctacccgtccggctcggccccgatgggctgctacccg
ggaggcgggggcggggcgcagatggccgccgaggcgcctggcgtggatgccggggaggaa
gcagcagagccgagcgcgtcccctctgaccccccagcgcgaactgctgcagcgagcccgg
gagtacaacgcacgcctcttcggcctggcgcagcgcagcgcccgagccctgctcgactac
ggcgtcacggcggacgcgcgcgcgctgctggcgggacagcgccacctgctgacagctcaa
gacgagaacggagacacgccgctgcacctagccatcatccacgggcagaccagtgtcatc
gagcagatagcccatgtcatctaccatgcccggcaccttggtgttgtcaacctcaccaat
cacttgcaccagacgccgctgcacctggcagtgatcactgggcagacaggcgtggtgagc
ttcctgctgcaggtgggcgcagacccggcactactggatcggcatggagactccgcagtg
cacctagcgctccgggctggtgccagtgcccctgaactgctgcgcgtccttctgcgcagt
ggggttcccgctgttccccagctgttgcacatgccagactttgagggcctgtacccagta
cacctggcggtccgtgcccgaagccccgagtgcctggatctgctggtggacagtggggct
gaagtggaggctgcagagcggcaggggggccgaacagccctgcatttagccacagagatg
gaggagctggggttggtcacacatctggttaccaagctccgtgccaatgtgaatgcccgc
acctttgcgggaaacacacccctacacctggcagctggactgggatctcccaccctcacc
cgtctccttctaaaggccggtgctgacatccacgcagagaatgaggagcccctgtgccca
ctgccttcgccccccacctctggtagtgactcagattctgagggacctgagagggacacc
cgaggcagcttccggggccacacacctcttgacctcactcgcagcaccaaggtgaagacc
ttgctgctaaatgctgctcaggacaccacagcaccccccctgacccctcccagccctgca
gggccagagctgccccttgaggatacagtcctacagaacctggagcatctgctagatggg
ccaggagcccagggcagctgggcagagctggcagaacggctggggctgcgcagtctggtg
gatacatatcggaagacagcttcacccagcggcagcctcctgcgcagttacaagctggct
ggtggggacttggcgggcctgctggatgccctgtctgaaatgggcctggaggaaggagtg
aagctgctgaggggccctgaggcccgagacaagctgcccagcacagaggtgaaagaggac
agtgcatacgggagccagtcggtggaacaggagacagagaagctgggctcaccccctgag
ccaccaggagggctctgccacgggcacccccagcctcaggtgcactga

KEGG   Felis catus (domestic cat): 101085762Help
Entry
101085762         CDS       T02385                                 

Gene name
RELB
Definition
(RefSeq) LOW QUALITY PROTEIN: transcription factor RelB
  KO
K09253  transcription factor RelB
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04064  NF-kappa B signaling pathway
fca04380  Osteoclast differentiation
fca04625  C-type lectin receptor signaling pathway
fca05166  Human T-cell leukemia virus 1 infection
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101085762 (RELB)
   04064 NF-kappa B signaling pathway
    101085762 (RELB)
 09150 Organismal Systems
  09151 Immune system
   04625 C-type lectin receptor signaling pathway
    101085762 (RELB)
  09158 Development
   04380 Osteoclast differentiation
    101085762 (RELB)
 09160 Human Diseases
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101085762 (RELB)
   05169 Epstein-Barr virus infection
    101085762 (RELB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101085762 (RELB)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  beta-Scaffold factors with minor groove contacts
   RHR (Rel homology region) Rel/Ankyrin
    101085762 (RELB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RelB_transactiv RHD_DNA_bind RelB_leu_zip RHD_dimer
Motif
Other DBs
NCBI-GeneID: 101085762
NCBI-ProteinID: XP_023101687
Position
E2
AA seq 664 aa AA seqDB search
MPLRLVQAGRYKAPGQWARRPAAPGNSAAPPPPAARPARPGAPRSPGRRASSPACGPSPC
AARPTRDRPPDGAFWPPGLPACVFXSGPASGPSVPTGRAMPSRRVARPSAAPELGALGSA
DLSSLSLAVSRTTDELEIIDEYIKENGFGLEGAQPGPGEGLPRLVSRGAASLSTVTLGPR
GPPPPATPPPWGCPLGRILPPAPGPGPRPHLVITEQPKQRGMRFRYECEGRSAGSILGES
STEASKTLPAIELRDCGGLREVEVTACLVWKDWPHRVHPHSLVGKDCTDGVCRVRLRPHV
SPRHSFNNLGIQCVRKKEIEAAIERKIQLGIDPYNAGSLKNHQEVDMNVVRICFQASYRD
QQGQMRRMDPVLSEPVYDKKSTNTSELRICRINKESGPCTGGEELYLLCDKVQKEDISVV
FSRASWEGRADFSQADVHRQIAIVFKTPPYEDLEIVEPVTVNVFLQRLTDGVCSEPLPFT
YLPRDHDSYGVDKKRKRGMPDVLGELNSSDPHGIESKRRRKKPAFLDHFLPNHGSGPFLP
PSALLPDTDFFPGPVSLPGLEPPGGPDLLDDSFAYDDATAPTLFTMLDMLPPAPPLASAV
TGNGAAGPTVGEPSGPEPMTLDSYQAPGPGDGGTASLVGSNMFPNQYREVGFGGGLLSPG
PEAT
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgaggctggtgcaagctgggagatataaggccccaggccaatgggcgcgcagg
ccggcggcgccggggaattccgccgccccgcccccgcccgccgcccgcccggcccggccc
ggcgccccccgcagccccgggcgccgcgcgtccagcccggcctgtggccccagcccctgc
gccgctcgcccgacccgcgatcgtcctccggacggtgccttctggccgcccggcctgccc
gcgtgtgtgttttgatctgggccggcctccgggccgtccgtccccactggtcgggccatg
ccgagtcgccgcgtcgccagaccgtccgctgcgccggagctgggggccttggggtccgct
gacctctcctcgctctcgctcgccgtttccaggaccacggatgaattggagatcatcgac
gagtacatcaaggagaacggctttggcctggagggggcgcagccgggcccgggcgaggga
ctgccgcgcctggtgtctcgcggggccgcctccctgagcaccgtcaccctggggccccgc
ggccccccgcccccggccacgccgccgccctggggctgtcccctgggccggatcctgccc
ccggccccgggccccgggccgcggccgcacctggtcatcacggagcagcccaaacagcgc
ggcatgcgcttccgctacgagtgcgagggccgctcggccggcagcatcctcggggagagc
agcacggaggcgagcaagacgctgcccgccatcgagctccgggattgtggagggcttcgg
gaggtggaggtgaccgcctgcctggtgtggaaggattggcctcaccgagtccacccccac
agcctcgtggggaaagactgcaccgacggcgtctgcagggtgaggctccggcctcatgtc
agcccccggcacagctttaacaatctgggcatccagtgtgtgaggaagaaggagattgaa
gccgccattgagcggaagattcagctgggcatcgacccctacaacgctgggtccctgaag
aaccatcaagaggtggacatgaatgtcgtgaggatttgcttccaggcctcatatagggac
cagcagggacagatgcgccggatggaccctgtgctctctgagcccgtctatgacaagaag
tccacaaacacgtcagagctgcggatctgccgaattaacaaggagagtgggccgtgcacg
gggggcgaggagctctatctgctgtgcgacaaggtgcagaaagaggatatatcggtggtg
ttcagcagggcctcctgggaaggccgggcagacttctcccaggccgatgtgcaccgccag
atcgccattgtgttcaagacaccgccctatgaggacctggaaatcgttgagcctgtgacc
gtgaacgtcttcctgcagcggctcaccgacggggtctgcagtgaacctctgcccttcacg
tacctgcctcgggaccatgacagctacggagtggacaagaagcggaaacgggggatgccg
gacgtccttggggagctgaacagctccgacccccatggcatcgagagcaaacggcggagg
aaaaagccggccttcctggatcacttcctgcccaaccacggctcaggcccgttcctcccg
ccgtcagccctgctgccggatacagacttcttccctggccccgtgtccctacccggcctg
gagcccccaggggggccggacctcctggacgacagctttgcctacgatgacgccacagcc
cccacactcttcaccatgctggacatgttgcccccggcgccgccactcgccagcgctgtc
acgggcaacggggctgcagggcccactgttggagagccttccggccccgagccaatgaca
ctggactcataccaggccccaggccccggggacgggggcactgccagccttgtgggcagc
aacatgttccccaaccagtaccgcgaggtcggatttgggggagggctcctgtccccgggg
cccgaggccacgtag

DBGET integrated database retrieval system