KEGG   Felis catus (domestic cat): 101080579Help
Entry
101080579         CDS       T02385                                 

Gene name
NDUFV2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 2, mitochondrial
  KO
K03943  NADH dehydrogenase (ubiquinone) flavoprotein 2 [EC:7.1.1.2 1.6.99.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101080579 (NDUFV2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101080579 (NDUFV2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101080579 (NDUFV2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101080579 (NDUFV2)
   05012 Parkinson disease
    101080579 (NDUFV2)
   05016 Huntington disease
    101080579 (NDUFV2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101080579 (NDUFV2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101080579 (NDUFV2)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101080579 (NDUFV2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2Fe-2S_thioredx
Motif
Other DBs
NCBI-GeneID: 101080579
NCBI-ProteinID: XP_003995070
Ensembl: ENSFCAG00000028157
UniProt: A0A2I2V559
Position
D3
AA seq 249 aa AA seqDB search
MFFSAALRAKAAGLIAQWGRHIRNLHKTAVQNGAGGALFVHRDTPENNPDTPFDFTPENY
KRIEAIVGNYPEGHKAAAVLPVLDLAQRQNGWLPISAMNKVAEVLQVPPMRVYEVATFYT
MYNRKPVGKYHIQVCTTTPCMLRNSDSILEAIQKKLGIKVGETTPDKLFTLIEVECLGAC
VNAPMVQINDNYYEDLTPKDIEEIIDELKAGKIPKPGPRSGRFSCEPAGGLTSLTEPPKG
PGFGVQAGL
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgttcttctccgcggcgctccgggccaaggcggcaggcctcatcgcccagtggggaaga
catataaggaatttacataagacagctgtgcaaaatggagctggaggagccttatttgtt
cacagagatactcctgagaataacccagatactccatttgatttcacaccagaaaactat
aagaggatagaggcaattgtaggaaactatccagaaggacataaagcagcagctgtgctt
ccagtcctggatttagcccaaagacagaatggatggctgcccatctctgccatgaacaag
gttgcggaagttttacaggtacctccaatgagagtatatgaagtagcaactttttatacg
atgtataatcgaaagccagttggaaagtatcacattcaggtctgcactactacaccttgc
atgcttcgaaactctgacagcatactggaggccatccagaaaaagcttggaataaaggtt
ggggagacgacacctgataaacttttcactcttatagaggtggaatgtttaggggcctgt
gtaaatgcaccaatggttcaaataaatgacaactactatgaggatctgacacctaaggat
attgaagaaattattgacgagctcaaagctggcaaaattccaaaacctgggccaaggagt
ggacgcttctcttgtgagccagctggaggtcttacctctttgactgaaccacccaaagga
cctggctttggtgtgcaagcaggactttaa

KEGG   Felis catus (domestic cat): 101080736Help
Entry
101080736         CDS       T02385                                 

Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 subunit C2
  KO
K03968  NADH dehydrogenase (ubiquinone) 1 subunit C2
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101080736
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101080736
  09159 Environmental adaptation
   04714 Thermogenesis
    101080736
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101080736
   05012 Parkinson disease
    101080736
   05016 Huntington disease
    101080736
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101080736
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_C2
Motif
Other DBs
NCBI-GeneID: 101080736
NCBI-ProteinID: XP_011284942
Ensembl: ENSFCAG00000029444
UniProt: M3XBJ5
Position
D1
AA seq 120 aa AA seqDB search
MMSGRPGRVPLQFLPDEARSLPPPKLTDPRLVYMGFLGYCSGLIDNAIRRRPVVTAGLHR
QLLYVTSFVFIGYYLLKRQDYMYAVKDHDMFAYVKSHPEDFPEKDKKTYGDFLEEFHPVR
NT seq 363 nt NT seq  +upstreamnt  +downstreamnt
atgatgagcggacggccgggccgagtgcccttacagttcctgccggatgaggcccggagc
ctcccaccgcccaagctgaccgacccgagactcgtctacatgggtttcttgggctactgc
tccggcctgattgataacgcgatccggcgaaggccggtggtgactgccggtttacatcgc
cagcttctatatgttacttcttttgtctttattggatattatcttttaaaacgtcaagat
tatatgtatgctgtgaaggaccatgatatgtttgcatatgtaaaatcacatccagaggat
tttcctgaaaaagataagaaaacttatggtgactttcttgaagaattccatccagtgcgt
tga

KEGG   Felis catus (domestic cat): 101081479Help
Entry
101081479         CDS       T02385                                 

Gene name
NDUFA12
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 12
  KO
K11352  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 12
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081479 (NDUFA12)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101081479 (NDUFA12)
  09159 Environmental adaptation
   04714 Thermogenesis
    101081479 (NDUFA12)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081479 (NDUFA12)
   05012 Parkinson disease
    101081479 (NDUFA12)
   05016 Huntington disease
    101081479 (NDUFA12)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101081479 (NDUFA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFA12
Motif
Other DBs
NCBI-GeneID: 101081479
NCBI-ProteinID: XP_003989165
Ensembl: ENSFCAG00000023050
UniProt: M3WRN3
Position
B4
AA seq 145 aa AA seqDB search
MEFLQVLKRGLQQLSGHGGLRGYLRVFFRANDVRVGTLVGEDKYGNKYYEDNKQFFGRHR
WVIYTTEMNGKNTFWDVDGSMVPPEWHRWLHSMTDDPPTTKPPIARKFIWTNHKFNVSGT
PEQYVPYSTTRKKIQEWVPPSTPYK
NT seq 438 nt NT seq  +upstreamnt  +downstreamnt
atggagttcctgcaggtcctgaaacgcgggctgcagcagctcagcggccacggtggcctc
cgcggctatctacgagttttcttcagggcaaacgatgtgagggttggtacattagtgggg
gaagacaaatatggaaacaaatactatgaggacaacaagcaattttttggtcgtcaccga
tgggttatatatacaactgaaatgaatggcaagaacacgttttgggatgtggatggaagc
atggtcccccctgaatggcatcgttggcttcactctatgactgatgatcctccaacaaca
aaaccacctatcgctcgtaaattcatttggacaaaccataagttcaatgtgagtggcact
ccagaacaatatgtaccttattctaccactagaaagaagattcaagagtgggtcccacct
tcaacaccttacaagtaa

KEGG   Felis catus (domestic cat): 101081685Help
Entry
101081685         CDS       T02385                                 

Gene name
NDUFA3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 3 isoform X2
  KO
K03947  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081685 (NDUFA3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101081685 (NDUFA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101081685 (NDUFA3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081685 (NDUFA3)
   05012 Parkinson disease
    101081685 (NDUFA3)
   05016 Huntington disease
    101081685 (NDUFA3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101081685 (NDUFA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADHdh_A3
Motif
Other DBs
NCBI-GeneID: 101081685
NCBI-ProteinID: XP_003997494
Position
E2
AA seq 115 aa AA seqDB search
MRTRRLSEASGAGTTTPRVLRALAAAAYATKMAGRLTAFLKDVWAKEPVLVASFTIAGLA
VILPTISPFTKYATMINQATPYNYPVPLRDDGNMPDVPSHPQDPEGPSLEWLKKL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atgcgcacgcgcagactcagcgaagcctccggcgcagggaccacaactcccagagtgctc
cgcgctcttgccgccgccgcctacgcgaccaagatggccgggagactcaccgccttcctc
aaggatgtctgggccaaggagccggtgctggtcgcgtccttcaccatcgcgggcctcgct
gtaattctgcccaccatcagccccttcaccaaatatgccaccatgatcaaccaggccacg
ccctacaactatccagtgcccctccgagatgatgggaacatgcctgacgtgcccagccac
ccccaggaccctgagggtccaagcttggagtggctgaagaaactgtga

KEGG   Felis catus (domestic cat): 101082389Help
Entry
101082389         CDS       T02385                                 

Gene name
NDUFB2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 2, mitochondrial
  KO
K03958  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101082389 (NDUFB2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101082389 (NDUFB2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101082389 (NDUFB2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082389 (NDUFB2)
   05012 Parkinson disease
    101082389 (NDUFB2)
   05016 Huntington disease
    101082389 (NDUFB2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101082389 (NDUFB2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_B2
Motif
Other DBs
NCBI-GeneID: 101082389
NCBI-ProteinID: XP_003983159
Ensembl: ENSFCAG00000027401
Position
A2
AA seq 105 aa AA seqDB search
MSALKRLAPFFPVGNRLFKGRGSGAAGGTGVRHAGDGVHIEPRYRQFPQLTKSQVIQAEF
FSGTMWFWILWRFWHDSDAVLGHFPYPDPSQWTDEELGILPDDED
NT seq 318 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctctgaagcggttggcgcctttctttccggttggaaaccgcttgttcaaaggc
cgcggctccggggcggctggaggcactggagtccgtcatgccggtgacggggtgcatatc
gagcctcggtataggcagtttccccagctgaccaagtcccaggtgatccaggccgagttc
ttcagtgggaccatgtggttctggattctctggcgtttttggcatgactcggatgctgtg
ctgggtcactttccatatccagatccttcccagtggacagatgaagaactaggtatcctc
cctgatgacgaagactga

KEGG   Felis catus (domestic cat): 101083475Help
Entry
101083475         CDS       T02385                                 

Gene name
NDUFB10
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 10
  KO
K03966  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101083475 (NDUFB10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101083475 (NDUFB10)
  09159 Environmental adaptation
   04714 Thermogenesis
    101083475 (NDUFB10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101083475 (NDUFB10)
   05012 Parkinson disease
    101083475 (NDUFB10)
   05016 Huntington disease
    101083475 (NDUFB10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101083475 (NDUFB10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFB10 DUF3926
Motif
Other DBs
NCBI-GeneID: 101083475
NCBI-ProteinID: XP_003998996
Ensembl: ENSFCAG00000011738
Position
E3
AA seq 176 aa AA seqDB search
MPDSWDKDVYPEPPRRTPAPSPKTSLPNPITYVTKAFDLLVDRPVTLVREFIERQHAKNR
YYYYHREFRRVPDITECQEKDVLCMFEAEMQWRRDYKVDQEIVNIIQERLKACQQREGES
YRENCAKEMEQFAQVAKAYQDRYHDLGAHYSARKCLAKQKQRMLAERKAAKEAAAA
NT seq 531 nt NT seq  +upstreamnt  +downstreamnt
atgccggatagctgggataaggacgtgtaccccgagcccccgcgccgcacaccggcgccc
tcgccgaagacctcgctgcccaaccccataacctatgtgacgaaggccttcgatctcctc
gtggaccgacctgtgaccctagtgagagagtttatagagcggcagcatgcgaagaacagg
tattactactaccatcgggagttccgtcgtgtgccagacatcaccgagtgccaggaaaag
gatgtcttgtgcatgtttgaagcagaaatgcaatggaggagagactataaagttgatcaa
gaaatcgtcaatattatccaggaaaggctgaaggcgtgtcagcagagggaaggcgagagc
tacagggagaactgcgccaaggagatggagcagtttgcccaggtggccaaggcctaccag
gaccgctatcacgacctgggtgcccattattcagccagaaagtgcctggcgaagcagaag
cagcggatgctggcagagagaaaagctgctaaagaggccgccgctgcgtga

KEGG   Felis catus (domestic cat): 101084209Help
Entry
101084209         CDS       T02385                                 

Gene name
NDUFA6
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 6
  KO
K03950  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084209 (NDUFA6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101084209 (NDUFA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    101084209 (NDUFA6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084209 (NDUFA6)
   05012 Parkinson disease
    101084209 (NDUFA6)
   05016 Huntington disease
    101084209 (NDUFA6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101084209 (NDUFA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_LYR Complex1_LYR_2 DUF4252
Motif
Other DBs
NCBI-GeneID: 101084209
NCBI-ProteinID: XP_003989398
Ensembl: ENSFCAG00000025921
UniProt: M3WRH9
Position
B4
AA seq 128 aa AA seqDB search
MAASGLRRAAVAAPTSVKPIFSRDMNEAKRRVRELYRAWYREVPNTVHLFQLDITVKQGR
DKVREMFMKNAHVTDPRVVDLLVIKGKMELEETINVWKQRTHVMRFFHETEAPRPTDFLS
KFYIGHDP
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgagcgggctccggcgagctgcagtcgcggctcccacttcagtgaaacccatt
tttagtcgggacatgaacgaagccaagcggagggtgcgcgagttgtaccgcgcctggtat
cgagaggtgccgaacactgtgcacttattccagctagacatcaccgtgaaacagggacgg
gataaagtccgagaaatgttcatgaagaatgcccacgtcacggaccccagggtggttgat
cttctggtcattaagggaaagatggaactggaggaaacaattaacgtctggaagcagcgg
acacacgttatgcggttcttccatgaaacagaagcgccgaggccgacggatttcctgtcc
aagttctacattggccacgacccgtga

KEGG   Felis catus (domestic cat): 101084817Help
Entry
101084817         CDS       T02385                                 

Gene name
NDUFV3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 3, mitochondrial
  KO
K03944  NADH dehydrogenase (ubiquinone) flavoprotein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101084817 (NDUFV3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101084817 (NDUFV3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101084817 (NDUFV3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084817 (NDUFV3)
   05012 Parkinson disease
    101084817 (NDUFV3)
   05016 Huntington disease
    101084817 (NDUFV3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101084817 (NDUFV3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUFV3 IMUP
Motif
Other DBs
NCBI-GeneID: 101084817
NCBI-ProteinID: XP_011284082
Position
C2
AA seq 472 aa AA seqDB search
MAASLLLRQGRSGAMKTMLLDARVFRGLAPSVSLSAESGKSKKGLPPNPKKQSPPKNVVE
PKERGQLVATPTAAELSKNLSSPRAHPSVVSAGGLVAGPGPGPEGSMLFTAEGAPEFRLR
KTVVETPQKVPSPLRKQGTDAKALRENRGDDSSSSSSSSSSSDSDSEGEGESSTADPQGT
SRGRGGPPRPQASRPLEDGAPRIAVVAKEKPRSQPDVPPPERPRPVKKKGGTIKPPEDRK
DTKRKTTTPKSQADKEFMKQNVKEKQFQKVLRSSETDKEGQKLPKVKEVLPAHTESGLST
QPAGGPAPIQWRERTGTARPPPAAPEASERHRGQHAAERGGEVAFPLFSKENLGAQVTEG
TLKAAGETLEGQAPVRSLKPVPAPSEGDFQDKAAGPEPEGGAGMAEDPAPPGGPDGTQES
AHAASASEPLDNATYKNLQHHDYTPYTFLDLNLDLSKFRMPQPSSGRESPRH
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atggcggcctctcttctgctgcggcaaggacggtcgggggcaatgaagactatgctccta
gacgcacgagtgtttcgaggacttgctccctcagtgtctctctctgcggaatcagggaag
agcaaaaagggactgccaccaaatcccaagaagcaaagtccaccaaaaaatgtagtggaa
ccaaaggagaggggccaactcgtagccaccccaacagcagctgaattgtctaaaaacttg
tcttcaccccgtgctcacccgtcagttgtgagtgcgggcgggctggtagctggccccggc
cccggccccgaaggcagcatgctattcacagccgaaggggctccggagttccggttgcga
aagactgtcgtagagacgcctcagaaagttccgtctccactcaggaagcagggcacggat
gcaaaagctcttagggagaacaggggagatgattcatcttcatcgtcctcttcgtccagc
tcctccgattccgactccgagggggaaggggagagctccacagctgacccccaggggacg
agcaggggcagaggagggcctcccagaccgcaggcgtcccgccccctcgaagatggagcc
cccagaattgcagtagtcgccaaagagaagccccgctcgcagccagatgtcccccctccc
gagaggccccgtccggtcaagaagaaagggggcaccatcaagccaccagaggacagaaaa
gacacaaaacgcaaaaccacaacacccaagtcacaagcagataaagagtttatgaagcaa
aacgtcaaggaaaagcaattccagaaagttcttagatcaagtgaaaccgataaagaaggc
caaaagctgcccaaagtcaaagaagtcctgcctgctcatacagagtcaggattgtccaca
cagccggctggcggcccagcgccaattcagtggagggaaagaactggaacagcaagaccg
ccgccagccgctcctgaggccagcgagagacaccggggccaacacgcagcggagcgtggt
ggggaggtggctttccccctgttcagcaaagaaaatttgggggcgcaggtgacagaggga
accctgaaggccgcgggagagactctggaaggtcaggcgccagtccgaagtttgaagccg
gttcctgctcctagcgaaggcgatttccaggacaaggccgcgggcccagagcctgagggc
ggggccgggatggcagaagaccctgcccctccaggagggccggacggcacccaggagtcc
gctcacgccgccagcgcctccgagccactggacaacgccacctacaagaacctgcagcac
cacgactataccccgtacaccttcttagacctcaacctggacctgtccaagttcaggatg
ccccagccctcgtcaggacgggagtcccctcgccactga

KEGG   Felis catus (domestic cat): 101085609Help
Entry
101085609         CDS       T02385                                 

Gene name
NDUFA1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 1
  KO
K03945  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101085609 (NDUFA1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101085609 (NDUFA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101085609 (NDUFA1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085609 (NDUFA1)
   05012 Parkinson disease
    101085609 (NDUFA1)
   05016 Huntington disease
    101085609 (NDUFA1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101085609 (NDUFA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MWFE zf-C5HC2
Motif
Other DBs
NCBI-GeneID: 101085609
NCBI-ProteinID: XP_004000887
UniProt: A0A2I2UTG4
Position
X
AA seq 70 aa AA seqDB search
MWFEILPGLGIMAVCLVIPGIATAHIHRFCNGGKEKRVAYYRYQWSLMQRDRRISGVNRY
YVSKGLENID
NT seq 213 nt NT seq  +upstreamnt  +downstreamnt
atgtggttcgagattctgcccggcctcggcatcatggccgtgtgcttggtcatccccggc
atagccactgcgcacatccacaggttctgtaacgggggcaaggaaaaaagggttgcctat
tatcggtatcagtggagtttgatgcaaagagacaggcgcatctctggagttaatcgttac
tatgtgtcaaagggtttggaaaatattgattaa

KEGG   Felis catus (domestic cat): 101085859Help
Entry
101085859         CDS       T02385                                 

Gene name
NDUFB9
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 9
  KO
K03965  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101085859 (NDUFB9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101085859 (NDUFB9)
  09159 Environmental adaptation
   04714 Thermogenesis
    101085859 (NDUFB9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085859 (NDUFB9)
   05012 Parkinson disease
    101085859 (NDUFB9)
   05016 Huntington disease
    101085859 (NDUFB9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101085859 (NDUFB9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_LYR Complex1_LYR_2 ImpA_N
Motif
Other DBs
NCBI-GeneID: 101085859
NCBI-ProteinID: XP_004000162
Ensembl: ENSFCAG00000004678
UniProt: A0A337SB28
Position
F2
AA seq 179 aa AA seqDB search
MAFCAPGAYLTHQQKVLRLYKRALRHLESYCVHRDKYRYFACLLRARFEEHKNEKDMVKA
TQLLREAEEEFWHNQHPQPYVFPESPGGTSYERYECYKVPEWCLDDWHPSEKAMYPDYFA
KREQWKKLRRESWEREVKQLQEETPVGGPNTEALPPARKEGDLPPLWWHIVTRPRERPM
NT seq 540 nt NT seq  +upstreamnt  +downstreamnt
atggcgttctgcgcgccgggtgcctacctgacccaccagcagaaggtgttgcggctttat
aagcgggcgctgcgccacctggagtcgtattgtgtccacagggacaaataccgctacttt
gcttgtttgctgagagctcggtttgaagaacataagaatgaaaaggatatggtgaaggcc
acccaactgctgagggaggcagaggaagaattctggcacaatcagcaccctcagccgtac
gtcttccccgagtctccaggagggacctcctacgagagatatgagtgctacaaggttcct
gagtggtgcttagacgactggcatccgtccgagaaggcgatgtatccagactactttgcc
aagagagagcagtggaagaagctgcggagggagagctgggagcgggaggtcaagcagctg
caggaggaaaccccagtcggtggtcccaacactgaagctttgcccccggcccgaaaggaa
ggcgatttgccccccctgtggtggcatattgtgaccaggccccgggagcggcccatgtag

KEGG   Felis catus (domestic cat): 101086911Help
Entry
101086911         CDS       T02385                                 

Gene name
NDUFB1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 1
  KO
K03957  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101086911 (NDUFB1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101086911 (NDUFB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101086911 (NDUFB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101086911 (NDUFB1)
   05012 Parkinson disease
    101086911 (NDUFB1)
   05016 Huntington disease
    101086911 (NDUFB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101086911 (NDUFB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_oxidored
Motif
Other DBs
NCBI-GeneID: 101086911
NCBI-ProteinID: XP_003988014
UniProt: A0A2I2UM17
Position
B3
AA seq 112 aa AA seqDB search
MKRKKGLGFPPPPLSSSGRGEWQVPRPQLPPAPVAGLASALGRGVLFGTKAAAFMMNVIQ
IVRDHWVHILVPVGFVLGCYLDKKNDEKLTAFRNKSLLFKRELRPNEEVTWK
NT seq 339 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaggaagaaggggttaggtttcccaccgccacccctctcttcgagcgggcgtggc
gaatggcaggtcccaaggccgcagcttccgccggcgccggtggctgggctcgcctctgcc
ctgggtcgtggggtcctttttggcaccaaggccgcagcattcatgatgaacgtaattcag
attgttcgtgaccactgggtacatatacttgtgcctgtgggatttgtccttggatgttat
ctagacaaaaagaacgatgaaaagctaactgccttccggaacaagagtttgttgtttaaa
agagaattgagacccaatgaagaagtcacctggaagtaa

KEGG   Felis catus (domestic cat): 101088298Help
Entry
101088298         CDS       T02385                                 

Gene name
NDUFS2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 2, mitochondrial
  KO
K03935  NADH dehydrogenase (ubiquinone) Fe-S protein 2 [EC:7.1.1.2 1.6.99.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101088298 (NDUFS2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101088298 (NDUFS2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101088298 (NDUFS2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101088298 (NDUFS2)
   05012 Parkinson disease
    101088298 (NDUFS2)
   05016 Huntington disease
    101088298 (NDUFS2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101088298 (NDUFS2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101088298 (NDUFS2)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101088298 (NDUFS2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_49kDa NiFeSe_Hases
Motif
Other DBs
NCBI-GeneID: 101088298
NCBI-ProteinID: XP_023103742
Ensembl: ENSFCAG00000015763
Position
F1
AA seq 463 aa AA seqDB search
MAALRALRSLRGVAAQALRPGVGGRLPVQPSRGSRQWQPDMEWAEQFGGAVMYPTKETAH
WKPPPWNDVDPPKDTMVTNLTLNFGPQHPAAHGVLRLVMELSGEMVRKCDPHIGLLHRGT
EKLIEYKTYLQALPYFDRLDYVSMMCNEQAYSLAVEKLLNIQPPPRAQWIRVLFGEITRL
LNHIMAVTTHALDIGAMTPFFWMFEEREKMFEFYERVSGARMHAAYVRPGGVHQDLPLGL
MDDIYEFSKNFSLRIDELEEMLTNNRIWRNRTVDIGVVTAEDALNYGFSGVMLRGSGIQW
DLRKTQPYDVYDQVDFDVPIGSRGDCYDRYLCRVEEMRQSLRIILQCLNKMPPGEIKVDD
AKVSPPKRAEMKTSMESLIHHFKLYTEGYQVPPGATYTAIEAPKGEFGVYLVSDGSSRPY
RCKIKAPGFAHLAGLDKMSKGHMLADVVAIIGTQDIVFGEVDR
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctcagggctctgcgcagcctccgcggcgtcgcggcccaggcgctgcggccc
ggggtcgggggccggctgcccgttcagcccagcagaggttctcggcaatggcagccagat
atggaatgggcagagcagtttgggggagcggtcatgtaccccaccaaggaaacggcccac
tggaagcctccgccttggaatgatgtggaccctccaaaggacacaatggtgacgaacctg
accctgaactttgggccccagcacccagcagcccatggagtcctgcgactagtgatggag
ttgagtggggagatggtgcgcaagtgtgacccccacatcgggctgctgcaccgaggaacc
gagaagctcattgaatacaagacctatctgcaggctcttccatactttgaccggctagac
tatgtgtccatgatgtgtaatgagcaggcctactcactggctgtggagaagttactcaat
atccagcctccgccccgggcacagtggatccgagtgctgtttggagaaatcacacggctt
ttgaaccacattatggctgtgaccacacatgccctggacattggggctatgacccctttc
ttctggatgtttgaagagagggagaagatgtttgaattctacgagcgcgtgtctggggct
cggatgcatgctgcctacgtccggccaggaggtgtgcaccaggacctacccctggggctt
atggatgacatttatgagttttctaagaacttctcacttcggattgatgagttggaagag
atgctgaccaacaacaggatctggcgaaatcggacagtcgacattggggtcgtaacagcc
gaagacgcacttaactatggatttagtggcgtgatgctgcggggctcaggcatccagtgg
gacctgcggaagacccagccctatgatgtttacgaccaggtggactttgatgttcccata
ggctctcgaggggactgctacgacaggtacctgtgtcgggtggaggagatgcgccagtcc
cttcgaatcatcttgcagtgtctcaacaagatgcctcctggggagatcaaggtcgatgat
gccaaagtgtccccgcccaagcgagcagagatgaagacttccatggaatcactgatccac
cactttaagttgtatacagagggctaccaggttcccccgggggccacgtacaccgccatc
gaggctcctaagggagagttcggggtgtacctggtgtccgatggcagtagccgcccttac
cgatgcaagatcaaggctcctggtttcgcccacctggccggtttggacaagatgtcaaag
ggacacatgctggcggacgttgttgccatcataggtacccaagatattgtgtttggagaa
gtggatcggtga

KEGG   Felis catus (domestic cat): 101089135Help
Entry
101089135         CDS       T02385                                 

Gene name
NDUFB4
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 4 isoform X2
  KO
K03960  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101089135 (NDUFB4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101089135 (NDUFB4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101089135 (NDUFB4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101089135 (NDUFB4)
   05012 Parkinson disease
    101089135 (NDUFB4)
   05016 Huntington disease
    101089135 (NDUFB4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101089135 (NDUFB4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B4
Motif
Other DBs
NCBI-GeneID: 101089135
NCBI-ProteinID: XP_011284234
Position
C2
AA seq 129 aa AA seqDB search
MSFPKYQPSRLATLPSTLDPAEYDVSPEARKAQAERLAIRSRLKREYLLQYNDPSRRGLI
EDPALIRWTYARSANIYPNFRPTPKTSLLGALFGIGPLFFWFYVFKTDRDRKEKLIQEGK
LDRTFSISY
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atgtcgttccccaagtaccagccttcgcgcctggccactctaccctccaccctcgaccca
gccgaatacgacgtatctccagaagcccggaaggcgcaagccgagcggttggccataaga
tcccgacttaaacgggagtacctgcttcagtacaacgaccccagccgccgagggctcatc
gaagatcctgccttgattcgttggacctatgcaagatcagcaaatatctatcccaatttc
agacccactcccaagacctcactcttaggagctctatttggaattgggcccctcttcttc
tggttttatgttttcaaaactgacagagataggaaagaaaaactgatccaggaaggaaaa
ttggatcgaacatttagcatttcatattaa

KEGG   Felis catus (domestic cat): 101089240Help
Entry
101089240         CDS       T02385                                 

Gene name
NDUFS4
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 4, mitochondrial isoform X2
  KO
K03937  NADH dehydrogenase (ubiquinone) Fe-S protein 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101089240 (NDUFS4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101089240 (NDUFS4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101089240 (NDUFS4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101089240 (NDUFS4)
   05012 Parkinson disease
    101089240 (NDUFS4)
   05016 Huntington disease
    101089240 (NDUFS4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101089240 (NDUFS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETC_C1_NDUFA4
Motif
Other DBs
NCBI-GeneID: 101089240
NCBI-ProteinID: XP_003981469
Ensembl: ENSFCAG00000008870
UniProt: A0A2I2UUC0
Position
A1
AA seq 175 aa AA seqDB search
MAAVSMSVALRQMLWGKRAVAVAAISASRVPTRSLSTSTWRLAQDPARDAQLITVDEKLD
ITTLTGVPVEHIKTRKVRIFVPARNNMQSGVNNTKKWKMEFDTRERWENPLMGWASTADP
LSNMVLTFSTKEDAAAFAEKNGWSYDIEEKKVPKPKSKSYGANFSWNKRTRVSTK
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggtctcaatgtcagtggcgctgaggcaaatgttgtgggggaaaagggcagtg
gctgtagcggccatttccgcttccagggttcctaccaggtcattaagcacttccacatgg
aggctggcacaggacccagctcgagacgcacagctcataacagttgatgaaaaattggat
atcactactttaactggcgttccagtagagcatatcaaaactagaaaagtcaggatcttt
gttcctgctcgcaataacatgcagtctggagtaaacaacacaaagaaatggaagatggag
tttgataccagggagcgatgggaaaatcctttgatgggttgggcatcaacggctgatccc
ttgtccaacatggttctgaccttcagtactaaagaagatgcagctgcctttgcagaaaaa
aatgggtggagctatgacattgaagagaagaaggttccaaaacccaagtccaagtcttac
ggtgcaaatttttcttggaacaaaagaacaagagtatccacaaaatag

KEGG   Felis catus (domestic cat): 101090177Help
Entry
101090177         CDS       T02385                                 

Gene name
NDUFB5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 5, mitochondrial
  KO
K03961  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101090177 (NDUFB5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101090177 (NDUFB5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101090177 (NDUFB5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090177 (NDUFB5)
   05012 Parkinson disease
    101090177 (NDUFB5)
   05016 Huntington disease
    101090177 (NDUFB5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101090177 (NDUFB5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B5 PanZ
Motif
Other DBs
NCBI-GeneID: 101090177
NCBI-ProteinID: XP_004001218
Ensembl: ENSFCAG00000012365
Position
C2
AA seq 189 aa AA seqDB search
MAAMSLLQRASVTAVAALSGRRLGARLGFGGFLTRGFPKTVAPVRHSGDHGKRLFIIKPS
GFYDRRFLSLMKFYILLTGIPVAIGITLVNIFIGEAELAEIPEGYIPEHWEYFKHPISRW
IARTFFDSPEKNYEKTMAILRIEAEKADLRLKELEVRKLMRARGDGPWYQYPTIDKALID
HSPKATPDN
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcggcaatgagtctattgcagcgggcctcggtcactgcagtggccgctctctccggc
cgccggcttggcgctcgacttggattcgggggcttcctcacccgtggctttccgaagact
gtcgctcctgtgcgacacagtggagatcatgggaaaagactgtttatcatcaaaccttct
ggattctatgacaggcgttttttgagtttaatgaaattctacattttgttgactgggatt
ccagtagcaattggcataactctggtgaatatattcattggtgaggctgagttagcagaa
attccagaaggctatatcccagaacactgggaatacttcaagcatcctatctcaagatgg
attgcccgaactttctttgatagtcccgaaaagaattatgaaaaaacaatggctatcctt
cgaattgaagctgaaaaggctgatttacgattaaaggagctagaagtccgaaagttaatg
cgtgcaagaggcgatggtccctggtatcagtatccaaccattgacaaggcgctgattgat
cattctccaaaagcaactcctgacaactaa

KEGG   Felis catus (domestic cat): 101091174Help
Entry
101091174         CDS       T02385                                 

Gene name
NDUFA7
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 7
  KO
K03951  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101091174 (NDUFA7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101091174 (NDUFA7)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091174 (NDUFA7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091174 (NDUFA7)
   05012 Parkinson disease
    101091174 (NDUFA7)
   05016 Huntington disease
    101091174 (NDUFA7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091174 (NDUFA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CI-B14_5a
Motif
Other DBs
NCBI-GeneID: 101091174
NCBI-ProteinID: XP_003981834
Ensembl: ENSFCAG00000015214
UniProt: M3WM64
Position
A2
AA seq 113 aa AA seqDB search
MASATRFIQRLRNWASGQDLQAKLQLRYQEISKRTQPPPQLPVGPSHKLSSNYYCTRDGR
REAVPPSVVMSSQKVLASGKPAESSPAAATEKKAVSPAPPIKRWELSKDQPYL
NT seq 342 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccgctacccgcttcatccagcggctgcggaactgggcgtccgggcaagacttg
caggcgaagttgcagctgcgctaccaggagatctccaagcgaactcagcctcctccccag
ctccctgtgggccccagccacaagctctccagcaactactactgcactcgcgatggccgc
cgggaagctgtgccaccatcagtcgtcatgtcctcgcagaaggtactggcgtcgggcaag
cctgcagagagctcacctgccgctgccactgagaagaaggccgtgtcgccggctcctccc
ataaagaggtgggagctgtccaaggaccagccttacctgtga

KEGG   Felis catus (domestic cat): 101091412Help
Entry
101091412         CDS       T02385                                 

Gene name
NDUFA8
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 8
  KO
K03952  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101091412 (NDUFA8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101091412 (NDUFA8)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091412 (NDUFA8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091412 (NDUFA8)
   05012 Parkinson disease
    101091412 (NDUFA8)
   05016 Huntington disease
    101091412 (NDUFA8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091412 (NDUFA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHCH Cmc1 CX9C
Motif
Other DBs
NCBI-GeneID: 101091412
NCBI-ProteinID: XP_003995871
Ensembl: ENSFCAG00000011185
Position
D4
AA seq 206 aa AA seqDB search
MRRPEVALGGRKGISRRRGRRGCGRLLGVGATAVMPGIVELPTVEDLKVQEVKVSSSVLK
AAAHHYGAQCDKPNKEFMLCRWEEKDPRRCLEEGRLVNKCALDFFRQIKLHCAEPFTEYW
TCIDYSSLQLLRRCRKQQAKFDECVLDKLGWVRPDLGELSKVTKVKTDRPLPENPYHSRA
RPEPNPEVEGDLKPAKHGSRLFFWTM
NT seq 621 nt NT seq  +upstreamnt  +downstreamnt
atgcgcaggcccgaggtggcccttggcggtcgaaaggggatttcaaggagacgggggcga
cgcggctgcgggcgcctcctcggggtcggggctaccgccgtcatgccggggatagtggag
ctgcccactgtggaggatctgaaagtgcaggaggtgaaagtcagttcttcggtgctgaaa
gctgccgcccaccactatggagctcagtgtgataagcccaacaaggagttcatgctctgt
cgctgggaagagaaagaccccaggcggtgtttagaggaaggcaggctcgtcaacaagtgt
gctctggacttcttcaggcagataaagcttcactgtgcggagccttttaccgaatattgg
acctgcattgattactccagcctgcagttacttcgtcgctgtcgcaaacagcaggccaag
tttgacgagtgtgtgctggacaaactgggctgggtgcgacctgacctcggagagctgtcc
aaggtcactaaagtgaaaacagatcgacctttaccggagaatccctatcactcgagagca
agaccagagcccaaccctgaggtagaaggagacctgaagcctgccaaacatggcagccgc
ctttttttctggaccatgtaa

KEGG   Felis catus (domestic cat): 101091655Help
Entry
101091655         CDS       T02385                                 

Gene name
NDUFB8
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 8, mitochondrial isoform X1
  KO
K03964  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101091655 (NDUFB8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101091655 (NDUFB8)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091655 (NDUFB8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091655 (NDUFB8)
   05012 Parkinson disease
    101091655 (NDUFB8)
   05016 Huntington disease
    101091655 (NDUFB8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091655 (NDUFB8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B8
Motif
Other DBs
NCBI-GeneID: 101091655
NCBI-ProteinID: XP_003994366
Ensembl: ENSFCAG00000006453
Position
D2
AA seq 186 aa AA seqDB search
MAAARARVLGVRWLQRAARTVVPLGARTASHITKDMLPGPYPKTPEERAAAAKKYNMRVE
DYQPYPDDGMGYGDYPKLPDRSQQERDPWYDWDHQDLRLNWGEPMHWDLDMYIRNRVDTS
PTPVSWNLMCKHLFGFVAFMLFMFWVGETYPTYQPVGPKQYPYNNLYLERGGDPTKEPEP
VVHYEI
NT seq 561 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggccagggcgcgggtcctgggagtccgatggctgcaaagggcagcccggacc
gtggtgccgttgggtgcacggacagcttcgcacattaccaaggacatgctcccggggccc
tatcccaagaccccagaagaacgggccgccgccgccaagaagtataatatgcgagtagaa
gactaccaaccgtaccctgatgatggcatgggatatggggactacccaaagctccctgac
cgctcacagcaggagagggatccatggtatgactgggaccaccaagacctgaggttgaac
tggggtgagccgatgcactgggaccttgacatgtatatcaggaaccgtgtggacacatcc
cctacacctgtttcctggaatctcatgtgtaagcacctcttcggcttcgtggccttcatg
ctgttcatgttttgggttggggagacttaccccacctaccagcctgtggggccaaagcag
tatccttataacaatctgtacctggaaagaggcggcgatcccaccaaagagcctgagccg
gtggttcattatgagatctga

KEGG   Felis catus (domestic cat): 101091693Help
Entry
101091693         CDS       T02385                                 

Gene name
NDUFC1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 subunit C1, mitochondrial
  KO
K03967  NADH dehydrogenase (ubiquinone) 1 subunit C1
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101091693 (NDUFC1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101091693 (NDUFC1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091693 (NDUFC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091693 (NDUFC1)
   05012 Parkinson disease
    101091693 (NDUFC1)
   05016 Huntington disease
    101091693 (NDUFC1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091693 (NDUFC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NADH_dh_m_C1
Motif
Other DBs
NCBI-GeneID: 101091693
NCBI-ProteinID: XP_003985043
Ensembl: ENSFCAG00000008548
UniProt: A0A2I2UI96
Position
B1
AA seq 76 aa AA seqDB search
MAPPALLRPFSKLLAPARIPSGSSARSKFYVREPAHDRPDWLKVGLTLGTSVFLWIYLIK
QHNEDVLEYKRRNGLE
NT seq 231 nt NT seq  +upstreamnt  +downstreamnt
atggcgccgcccgcgttgttgcgcccgttttccaagctgctggctccggccaggatccca
agtggctcttcagcgcgatcaaaattctacgtgcgggagccggcacatgaccgacctgac
tggctgaaagttggactgaccttgggcacctccgtcttcttgtggatctatctcatcaaa
caacataatgaagatgttttagagtataaaagaagaaatgggttggaataa

KEGG   Felis catus (domestic cat): 101091711Help
Entry
101091711         CDS       T02385                                 

Gene name
NDUFA4L2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 4-like 2
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101091711 (NDUFA4L2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101091711 (NDUFA4L2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091711 (NDUFA4L2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091711 (NDUFA4L2)
   05012 Parkinson disease
    101091711 (NDUFA4L2)
   05016 Huntington disease
    101091711 (NDUFA4L2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091711 (NDUFA4L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B12D
Motif
Other DBs
NCBI-GeneID: 101091711
NCBI-ProteinID: XP_003988984
Ensembl: ENSFCAG00000000189
UniProt: M3VU93
Position
B4
AA seq 87 aa AA seqDB search
MAGTSVGARFYRQIKRHPALIPMIGFIGLGMGSAALYLLRLALRSPDVCWDRKNNPEPWN
RLSPNDQYKFLAVSTDYKKLKKDRPDF
NT seq 264 nt NT seq  +upstreamnt  +downstreamnt
atggcgggaacgagtgtcggggcccgcttctaccggcagatcaagagacatcccgcgctc
atcccgatgatcggcttcattggtctgggaatgggcagcgctgcgctgtacttgctgaga
ctcgccctgcgcagccccgacgtctgctgggacagaaagaacaacccggagccctggaac
cgcctgagccccaatgaccaatacaagtttcttgcagtttccaccgactataagaagctg
aagaaggaccggccggacttttga

KEGG   Felis catus (domestic cat): 101091850Help
Entry
101091850         CDS       T02385                                 

Gene name
NDUFB7
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 7
  KO
K03963  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 7
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101091850 (NDUFB7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101091850 (NDUFB7)
  09159 Environmental adaptation
   04714 Thermogenesis
    101091850 (NDUFB7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101091850 (NDUFB7)
   05012 Parkinson disease
    101091850 (NDUFB7)
   05016 Huntington disease
    101091850 (NDUFB7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101091850 (NDUFB7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B7 Cmc1
Motif
Other DBs
NCBI-GeneID: 101091850
NCBI-ProteinID: XP_003981990
Ensembl: ENSFCAG00000013496
UniProt: M3WIY9
Position
A2
AA seq 137 aa AA seqDB search
MGAHLARRYVTDPSGEPDPQRMPTFPPDYGFPGRKEREMVATQQQMNDAQLALQQRDYCA
HYLIRLLKCKRDSFPNFLACKHEQHAWDHCEHLDYVMRMKEFERERRLLQRKKRREQRAA
DVAQGQGPGEVAPEVAL
NT seq 414 nt NT seq  +upstreamnt  +downstreamnt
atgggggcgcatctcgcccggcgctatgtgaccgatccgtcgggggaacccgacccccag
cggatgcccaccttcccccccgactacggcttcccggggcgcaaggagcgcgagatggtg
gccacacagcagcagatgaatgacgcgcagctggcgctccagcagcgagactactgcgcc
cactacctcatccggctgctcaagtgcaagcgtgacagcttccccaacttcctggcctgc
aagcacgagcagcacgcctgggaccactgcgagcacctcgactacgtgatgcgcatgaag
gagtttgagcgggaacggaggctgctccagcggaagaagcggcgggagcagcgggcggca
gacgtggcccaaggccaggggcccggcgaggtggcccccgaggtagccctgtag

KEGG   Felis catus (domestic cat): 101092508Help
Entry
101092508         CDS       T02385                                 

Gene name
NDUFA5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 5 isoform X1
  KO
K03949  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101092508 (NDUFA5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101092508 (NDUFA5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101092508 (NDUFA5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101092508 (NDUFA5)
   05012 Parkinson disease
    101092508 (NDUFA5)
   05016 Huntington disease
    101092508 (NDUFA5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101092508 (NDUFA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ETC_C1_NDUFA5 NEL Methyltransf_16
Motif
Other DBs
NCBI-GeneID: 101092508
NCBI-ProteinID: XP_003983037
Ensembl: ENSFCAG00000027125
UniProt: A0A2I2UU35
Position
A2
AA seq 116 aa AA seqDB search
MAGLLKKTTGLVGLAVCESPHERLRILYTKILDVLEQIPKNAAYRKYTEQITNEKLSMVK
AEPDVKKLEDQLQGGQLEEVILQAENELSLARKMIQWKPWEPLVEEPPANQWKWPI
NT seq 351 nt NT seq  +upstreamnt  +downstreamnt
atggcgggtttgctgaagaagaccacgggccttgtgggattggctgtgtgtgagagtcca
cacgagaggctaagaatactgtacacaaagattcttgatgttcttgagcaaattcctaaa
aatgcagcatatagaaagtatacagaacagattacaaatgaaaagttgagtatggttaaa
gcggaaccagatgttaagaaattagaagaccaacttcagggtggccaactggaagaggtg
attcttcaggctgaaaatgaactaagtctggcaagaaaaatgatacagtggaaaccatgg
gagcctttagtggaagagcctcctgccaaccaatggaaatggccaatataa

KEGG   Felis catus (domestic cat): 101092862Help
Entry
101092862         CDS       T02385                                 

Gene name
NDUFA9
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 9, mitochondrial
  KO
K03953  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 9
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101092862 (NDUFA9)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101092862 (NDUFA9)
  09159 Environmental adaptation
   04714 Thermogenesis
    101092862 (NDUFA9)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101092862 (NDUFA9)
   05012 Parkinson disease
    101092862 (NDUFA9)
   05016 Huntington disease
    101092862 (NDUFA9)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101092862 (NDUFA9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Epimerase 3Beta_HSD NmrA NAD_binding_10 RmlD_sub_bind NAD_binding_4 GDP_Man_Dehyd
Motif
Other DBs
NCBI-GeneID: 101092862
NCBI-ProteinID: XP_003988339
Ensembl: ENSFCAG00000005951
UniProt: M3W510
Position
B4
AA seq 377 aa AA seqDB search
MAAAFHPRVVRALPMSRSSITARAVAVFHGPPHRQLHHSLIPHGKGGRSSVSGVVATVFG
ATGFLGRYVVNRLGRMGSQVIIPYRCEAYDTMHLRPMGDLGQIIFLEWNGKDKDSIRRAV
KHSNVVINLVGREWETKNFDFEDVFVKIPQAIAQVSKEAGVEKFIHVSHLNADIKSSSRY
LRNKAVGEKEVRDAFPEAIIIKPSDIFGREDRFLNHFANIRWFGGVPLISLGKKTVKQPV
YVVDVSKGIVNAIKDPDARGKSFAFVGPSRYLLFDLVQYVFAMAHRPFLPYPLPHFAYQW
VARLFEMSPFEPWTTRDKVERLHITDMVLPHLPGLEDLGIQATPLELKAIEVLRRHRTYR
WLSSEIEDVKPAKTVTF
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgccttccaccctagggttgtccgagccctgccaatgtcacgttcttctatt
actgcgagagccgtagctgtgtttcatggccctcctcatcgccagcttcatcattcactc
atacctcatgggaaaggtgggcgttcttcagtcagtggggttgtggccactgtgtttgga
gcaacgggattcttgggccgatatgttgtcaaccgccttggacgtatggggtcacaggtg
atcataccctatcggtgtgaagcatatgacaccatgcaccttcgtcccatgggtgacctg
ggtcagattatctttctggaatggaatggcaaggacaaagattctatccgaagagcagtg
aagcacagcaatgtggtcattaatcttgttgggcgagaatgggaaaccaaaaactttgat
tttgaggatgtttttgtgaagattccccaagcaattgctcaagtgtccaaggaagctgga
gttgaaaaattcattcatgtttcacatctgaatgctgatattaaaagctcttctagatat
ctgagaaataaggctgttggagagaaggaagtgagagatgcctttccggaagccattatc
ataaagccgtcggacatctttggaagagaagatagattcctcaatcattttgcaaatatc
cgttggtttggtggtgtacctcttatttccttgggcaagaagacagtgaaacaaccagtc
tatgttgtagatgtatcaaaaggaattgttaatgccattaaggatccagatgccagaggg
aaatcttttgcctttgttgggcccagtcggtacctcctttttgacctggtgcagtatgtc
tttgctatggctcacagacctttcctcccgtaccctctgccacattttgcctatcagtgg
gtagcacgactctttgaaatgagtccgtttgagccctggacaacgagggataaagtggag
cggcttcacatcacagacatggtattgccacacctgcccggcttggaggacctcggaatt
caggcaacgccgctggaactcaaggccattgaggtgctgcggcgccatcgtacataccgt
tggctgtcgtctgaaattgaagacgtgaagccggccaagactgtcaccttctag

KEGG   Felis catus (domestic cat): 101093382Help
Entry
101093382         CDS       T02385                                 

Gene name
NDUFB3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 3 isoform X2
  KO
K03959  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101093382 (NDUFB3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101093382 (NDUFB3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101093382 (NDUFB3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093382 (NDUFB3)
   05012 Parkinson disease
    101093382 (NDUFB3)
   05016 Huntington disease
    101093382 (NDUFB3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101093382 (NDUFB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B12
Motif
Other DBs
NCBI-GeneID: 101093382
NCBI-ProteinID: XP_003991063
Ensembl: ENSFCAG00000029710
UniProt: M3X4G0
Position
C1
AA seq 98 aa AA seqDB search
MAHGHGHEHGHGKLKLPDYKQWKIEGTPLETVQEKLAARGLRDPWGRNEAWRYMGGFANN
VSFVGALLKGFKWGFAAFVVAVGAEYYLESQKKEKKHH
NT seq 297 nt NT seq  +upstreamnt  +downstreamnt
atggcccatggacatggacatgaacatggtcatggtaaactaaaacttccagattataaa
caatggaagatagaagggacaccattagaaactgtccaggagaagctggctgcacgaggg
ctaagggatccatggggccgcaatgaagcttggagatacatgggtggctttgcaaacaat
gtttcctttgttggtgcattattaaaaggattcaaatggggatttgctgcatttgtggta
gctgtaggggctgaatattacctggagtcccagaaaaaagagaagaagcatcattga

KEGG   Felis catus (domestic cat): 101093395Help
Entry
101093395         CDS       T02385                                 

Gene name
NDUFV1
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] flavoprotein 1, mitochondrial
  KO
K03942  NADH dehydrogenase (ubiquinone) flavoprotein 1 [EC:7.1.1.2 1.6.99.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101093395 (NDUFV1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101093395 (NDUFV1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101093395 (NDUFV1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093395 (NDUFV1)
   05012 Parkinson disease
    101093395 (NDUFV1)
   05016 Huntington disease
    101093395 (NDUFV1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101093395 (NDUFV1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101093395 (NDUFV1)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101093395 (NDUFV1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_51K NADH_4Fe-4S SLBB
Motif
Other DBs
NCBI-GeneID: 101093395
NCBI-ProteinID: XP_003993754
Ensembl: ENSFCAG00000001757
UniProt: M3VX83
Position
D1
AA seq 464 aa AA seqDB search
MLAARRLLSGSLPARVSVRFSGDTTAPKKTSFGSLKDEDRIFTNLYGRHDWRLKGAQSRG
DWYKTKEILLKGPDWILGEVKTSGLRGRGGAGFPTGLKWSFMNKPSDGRPKYLVVNADEG
EPGTCKDREIIRHDPHKLVEGCLVGGRAMGARAAYIYIRGEFYNEASNLQVAIREAYEAG
LIGKNACGSGYDFDVFVVRGAGAYICGEETALIESIEGKQGKPRLKPPFPADVGVFGCPT
TVANVETVAVSPTICRRGGAWFASFGRERNSGTKLFNISGHVNHPCTVEEEMSVPLKELI
EKHAGGVTGGWDNLLAVIPGGSSTPLIPKSVCETVLMDFDALVQAQTGLGTAAVIVMDRS
TDIVKAIARLIEFYKHESCGQCTPCREGVDWMNKVMARFVKGDARPAEIDSLWEISKQIE
GHTICALGDGAAWPVQGLIRHFRPELEERMQRFARQHQARQAAS
NT seq 1395 nt NT seq  +upstreamnt  +downstreamnt
atgctggcggcacggcggctgctcagcgggtcgctccctgcgcgggtgtctgtgcgtttc
agcggcgacacgacagcacccaagaaaacctcatttggctcgctgaaggatgaagaccgg
atcttcaccaacctgtatggccgccatgactggaggctgaaaggtgctcagagccgaggt
gactggtacaagacaaaggagatcttgctgaaggggcctgactggatcctgggtgaggtc
aagacatccggcttgcggggccgtggcggtgctggcttccccactggcctcaaatggagc
ttcatgaataagccctcagatggcaggcccaagtatctagtcgtgaacgcagatgaaggg
gagccgggcacctgcaaggaccgggagatcattcgccacgatccccacaagctggtggaa
ggctgcctagttgggggccgggccatgggcgcccgtgctgcctacatctacatccgaggg
gaattctacaacgaggcctccaatctgcaggtggccatccgagaggcctatgaggctggt
ctgattggcaagaacgcctgtggctccggctacgattttgatgtgtttgttgtgcgtggg
gccggggcctacatctgtggggaggagacggcgctcattgagtccatcgagggcaaacag
ggcaagccgcgcctgaagccgcccttccctgctgatgtgggagtgttcggctgccccaca
accgtggccaacgtggagacggtggctgtgtcccccaccatctgccgtcgtgggggtgcg
tggtttgccagctttggtcgtgagcgcaactcgggcaccaaactgttcaatatctctggc
cacgtcaaccacccttgtactgtggaggaggagatgtctgtaccactgaaggaactgatt
gaaaagcatgcggggggtgtcacaggtggctgggacaacctccttgctgtgatccccggc
ggctcatccacgccactgatccccaagtccgtgtgtgagacggtgctgatggactttgac
gcgctggtgcaggcgcagacgggcctgggcacggctgctgtgattgtcatggaccgctcg
acggatatcgtgaaagctatcgcccgccttattgagttctacaagcacgagagctgtggc
cagtgtaccccatgccgcgagggtgtggactggatgaacaaggtgatggcccgcttcgtg
aagggggatgcccggccggccgagatcgactccctctgggagatcagcaagcagatagag
ggccataccatctgcgccctgggtgatggggccgcctggcccgtgcagggcctgatccgc
cacttccggccagagctcgaggagcggatgcagaggttcgcccggcagcaccaggccagg
caagctgcctcctga

KEGG   Felis catus (domestic cat): 101093631Help
Entry
101093631         CDS       T02385                                 

Gene name
NDUFA10
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 10, mitochondrial isoform X1
  KO
K03954  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101093631 (NDUFA10)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101093631 (NDUFA10)
  09159 Environmental adaptation
   04714 Thermogenesis
    101093631 (NDUFA10)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093631 (NDUFA10)
   05012 Parkinson disease
    101093631 (NDUFA10)
   05016 Huntington disease
    101093631 (NDUFA10)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101093631 (NDUFA10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: dNK Thymidylate_kin AAA_17 SKI Cytidylate_kin AAA_33 Cytidylate_kin2 AAA_18 TsaE
Motif
Other DBs
NCBI-GeneID: 101093631
NCBI-ProteinID: XP_023115709
Ensembl: ENSFCAG00000002205
Position
C1
AA seq 373 aa AA seqDB search
MALRLLRGLPASAAARGLAAVVQRVEGIHTGAQCRLQYGPLAYILGERTTKKFTEYSKVI
TVDGNICSGKGELAKQIAEKLGLKHFPEAGIHYADGATGDGRPLDVELSGSCSVEKFYED
PRSNDGNSYRLQSWLYASRLLQYADALEHLLSTGQGVVLERSIFSDFVFLDAMYNQGFIR
KQCVEHYNEVKKVTASEYLPPHVVIYIDVPVPEIQSRIQKKGNPHEMKVTSAYLQDIENA
YKKTFLPEMSEKCEVLQYSAREAQDAEKVVEDIEYLKYDKGPWLEQDDRTLHHLRMLVQN
KLEVLNYTTIPIYLPEITIGAHQSDRIFQKFTELQEIGRAWCSGRAGWTWPGGRGRVPRP
PQTGWPGPSVALS
NT seq 1122 nt NT seq  +upstreamnt  +downstreamnt
atggccttgaggctgctgagagggctccccgcctcggcggcggcgcggggcctggcggcg
gtcgtccagcgcgtggaaggaattcatacaggcgcccagtgcaggctacagtatggccct
ttggcatacatactcggcgaaagaaccaccaaaaaattcacagaatacagcaaagtgata
actgtagacggcaatatatgttctggaaaaggcgagcttgcaaaacaaatagcagagaaa
ctaggcttgaagcacttccccgaagccgggatccactacgcggacggcgcgacgggagac
gggaggcccctggacgtggagcttagcggcagctgcagcgtggagaagttttacgaggac
ccgagaagtaacgacggcaacagctaccgcctgcagtcctggctgtacgccagccgcctc
ctgcagtacgccgacgccctggagcacttgctgagcacgggacaaggtgtcgtattggaa
cgttccatcttcagcgactttgttttcttggacgcgatgtataaccaaggattcatccgg
aagcagtgtgtggagcactacaacgaggtgaagaaggtcaccgcctctgagtacctgcct
ccccacgtggtcatctacatcgacgtgccggttccggagatccagagtcggattcagaag
aaaggaaatccacacgaaatgaaggtcacctcggcctatctgcaggacatcgagaacgcc
tacaagaaaaccttcctgcctgagatgagtgagaagtgtgaggttttacagtatagcgca
agggaagctcaagatgcggaaaaggtggtggaggacatcgagtacctcaagtacgacaag
gggccgtggctggagcaggatgaccggactcttcaccacctgcggatgctggttcagaat
aagctggaggtgctgaattacacaaccattcccatctatctcccagaaatcacgatcgga
gctcaccagagtgaccgcatcttccagaaattcacagagctgcaggagatcggaagagcg
tggtgtagcggccgtgcaggatggacctggccaggtggacgagggagagtcccacggccc
ccacagacgggctggcctggaccctctgtggctctgagctga

KEGG   Felis catus (domestic cat): 101093917Help
Entry
101093917         CDS       T02385                                 

Gene name
NDUFA11
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 11
  KO
K03956  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 11
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101093917 (NDUFA11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101093917 (NDUFA11)
  09159 Environmental adaptation
   04714 Thermogenesis
    101093917 (NDUFA11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093917 (NDUFA11)
   05012 Parkinson disease
    101093917 (NDUFA11)
   05016 Huntington disease
    101093917 (NDUFA11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101093917 (NDUFA11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Tim17
Motif
Other DBs
NCBI-GeneID: 101093917
NCBI-ProteinID: XP_003981763
Ensembl: ENSFCAG00000016347
UniProt: M3WND4
Position
A2
AA seq 141 aa AA seqDB search
MVQTLLQRYRDIPDGTECHRKTYASTTLSGAAGLIFSAYSVTLQPPDSFLEGVARTGRYT
FTAAAIGAIFGLTSCISAQVREKPDDPLNYFIGGCAGGLTLGARTHSYGIGAAACAYMGT
IAALVKMGQLEGWKVFAAPKV
NT seq 426 nt NT seq  +upstreamnt  +downstreamnt
atggtgcagacgcttcttcagcgataccgggacattcccgatggcaccgagtgccaccgc
aagacctacgccagtaccacactgagtggtgccgctggcctgatattctccgcctacagt
gtcacgctgcagccgccagattccttcctggagggagtggcgaggacagggcgatacaca
tttactgcagccgccatcggtgccatatttggcctcacctcctgcatcagtgcccaggtc
cgagagaagcccgatgaccccctcaactacttcatcggaggctgtgccggaggcctgacc
ctgggagcgcgcactcacagctatgggatcggagccgccgcgtgcgcgtacatgggcacg
atcgccgcgttggtcaagatgggccagctggagggctggaaggtgtttgcagcacccaag
gtgtga

KEGG   Felis catus (domestic cat): 101094451Help
Entry
101094451         CDS       T02385                                 

Gene name
NDUFS8
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 8, mitochondrial isoform X2
  KO
K03941  NADH dehydrogenase (ubiquinone) Fe-S protein 8 [EC:7.1.1.2 1.6.99.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101094451 (NDUFS8)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101094451 (NDUFS8)
  09159 Environmental adaptation
   04714 Thermogenesis
    101094451 (NDUFS8)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094451 (NDUFS8)
   05012 Parkinson disease
    101094451 (NDUFS8)
   05016 Huntington disease
    101094451 (NDUFS8)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094451 (NDUFS8)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101094451 (NDUFS8)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101094451 (NDUFS8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer4 Fer4_7 Fer4_16 Fer4_21 Fer4_10 Fer4_9 Fer4_8 Fer4_6 Fer4_2 Fer4_4 Fer4_17 c-SKI_SMAD_bind Fer4_13 Fer4_18 Fer4_3 EPF
Motif
Other DBs
NCBI-GeneID: 101094451
NCBI-ProteinID: XP_003993759
Ensembl: ENSFCAG00000002988
UniProt: M3VZI9
Position
D1
AA seq 210 aa AA seqDB search
MHCLTTATLLRALAQAARAGHPSGRSLHSSTVAATYKFVNMRETSMDMKSVTDRAAQTLL
WTELIRGLGMTLSYLFREPATINYPFEKGPLSPRFRGEHALRRYPSGEERCIACKLCEAV
CPAQAITIEAEPRADGSRRTTRYDIDMTKCIYCGFCQEACPVDAIVEGPNFEFSTETHEE
LLYNKEKLLNNGDKWEAEIAANIQADYLYR
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgcactgcctgaccacagctacactgcttcgggccctggcccaggccgcacgtgcaggg
caccccagtggccggagcctccacagcagcacggtggcagcaacctacaagttcgtgaac
atgcgggagacctcgatggacatgaagtcggtgaccgaccgggcggctcagaccctgctg
tggactgagctcatccgaggcctgggcatgaccctgagctacctgttccgggaaccggcc
accattaactacccgttcgagaagggcccgctgagcccacgcttccggggggagcatgca
ctgcgccgctacccgtccggagaagagcgctgtatcgcctgcaagctttgtgaggccgtc
tgccccgcccaggccatcaccatcgaggccgagccgagggccgacggcagccgccggacc
acgcgctacgacatcgacatgaccaagtgcatctactgcggcttctgccaggaggcttgc
cccgtggacgccatcgtcgagggccccaactttgagttctccacggagacacacgaggag
ctgctctacaacaaggagaaactgctcaacaacggggacaagtgggaggccgagatcgcc
gccaacatccaggccgactacctgtaccgctga

KEGG   Felis catus (domestic cat): 101094940Help
Entry
101094940         CDS       T02385                                 

Gene name
NDUFS5
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 5
  KO
K03938  NADH dehydrogenase (ubiquinone) Fe-S protein 5
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101094940 (NDUFS5)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101094940 (NDUFS5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101094940 (NDUFS5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101094940 (NDUFS5)
   05012 Parkinson disease
    101094940 (NDUFS5)
   05016 Huntington disease
    101094940 (NDUFS5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101094940 (NDUFS5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ndufs5 Cmc1
Motif
Other DBs
NCBI-GeneID: 101094940
NCBI-ProteinID: XP_003989933
UniProt: M3X8I4
Position
C1
AA seq 106 aa AA seqDB search
MPFFDVQKRLGLNLDQWMTIQSAEQPHKIPGRCHAFEKEWIECAHGIGGIRAEKECKIEY
DDFVECLLRQKTMKRLSDIRRQRDKLIKEGKYTPPPHHLGKEDPRP
NT seq 321 nt NT seq  +upstreamnt  +downstreamnt
atgcctttctttgatgtgcagaaaaggctgggccttaacttagatcagtggatgacaatc
caaagtgctgagcagcctcacaagattccaggtcgatgccatgcttttgaaaaagaatgg
atagaatgtgcgcatggaatcggtggtatccgtgcagagaaagagtgcaagatagaatat
gatgatttcgtagaatgtctgcttcggcagaaaacgatgaaacgtctgagtgacatcagg
aggcagcgggataaactgataaaggaagggaagtacacacccccgcctcaccacttgggc
aaggaggaccctaggccctga

KEGG   Felis catus (domestic cat): 101096376Help
Entry
101096376         CDS       T02385                                 

Gene name
NDUFA2
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 2
  KO
K03946  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096376 (NDUFA2)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101096376 (NDUFA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101096376 (NDUFA2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096376 (NDUFA2)
   05012 Parkinson disease
    101096376 (NDUFA2)
   05016 Huntington disease
    101096376 (NDUFA2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096376 (NDUFA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: L51_S25_CI-B8
Motif
Other DBs
NCBI-GeneID: 101096376
NCBI-ProteinID: XP_003980891
Ensembl: ENSFCAG00000001282
UniProt: M3VWC9
Position
A1
AA seq 99 aa AA seqDB search
MAAAVASRGIRAKLGLREIRVHLCQRSPGSQGVREFIEKHYVELKKANPDLPILIRECSD
VQPKLWARYAFGQEKNVSLNNFSADQVTRAMENVLSGKA
NT seq 300 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggctgtagccagtcgcgggattcgggcaaaactgggcctgcgtgaaattcgc
gtccacttgtgccagcgctcgcctggcagtcagggcgtcagggaatttatcgagaaacac
tatgtggagctgaagaaggcgaaccctgacctgccaatcctaattcgcgagtgttccgat
gtgcagcccaagctctgggcccgttacgcatttggccaagagaagaatgtctctttgaat
aacttcagtgctgatcaagtaaccagagccatggagaatgtgctaagtggcaaagcctga

KEGG   Felis catus (domestic cat): 101096448Help
Entry
101096448         CDS       T02385                                 

Gene name
NDUFS7
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 7, mitochondrial
  KO
K03940  NADH dehydrogenase (ubiquinone) Fe-S protein 7 [EC:7.1.1.2 1.6.99.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096448 (NDUFS7)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101096448 (NDUFS7)
  09159 Environmental adaptation
   04714 Thermogenesis
    101096448 (NDUFS7)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096448 (NDUFS7)
   05012 Parkinson disease
    101096448 (NDUFS7)
   05016 Huntington disease
    101096448 (NDUFS7)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096448 (NDUFS7)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101096448 (NDUFS7)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101096448 (NDUFS7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Oxidored_q6
Motif
Other DBs
NCBI-GeneID: 101096448
NCBI-ProteinID: XP_023098670
Ensembl: ENSFCAG00000032042
Position
A2
AA seq 216 aa AA seqDB search
MAALAAPGLLRQILALRSGVGVALQGRSVHSSVAADSPSSTQPAVSKAGAVVPKPTALPS
SRGEYVVAKLDDLINWARRSSLWPMTFGLACCAVEMMHMAAPRYDMDRFGVVFRASPRQA
DVMIVAGTLTNKMAPALRKVYDQMPEPRYVVSMGSCANGGGYYHYSYSVVRGCDRIVPVD
IYVPGCPPTAEALLYGILQLQKKIKREKRLRIWYRR
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgctggcggctcccggccttctccgccagatccttgctctgcgctccggtgtg
ggcgtggctctgcagggtcgaagtgtccattcgagcgtggccgctgacagccccagcagc
acccagcccgctgtgtccaaggctggagccgtggtccccaagcccaccgcgcttcccagc
agccggggcgagtatgtggtggccaagctggacgacctcatcaactgggcccgccggagt
tccctgtggcccatgaccttcggcctggcctgctgcgccgtggagatgatgcacatggcc
gcgccccgctatgacatggaccgcttcggcgtggtcttccgcgccagcccgcgccaggcg
gacgtcatgatcgtggccggcacgctcaccaacaagatggccccggccctgcgcaaggtc
tatgaccagatgccggagcctcgctacgtcgtgtccatgggcagctgtgccaacggaggc
ggctactaccactactcgtactccgtcgtgaggggctgtgaccgcatcgtgcccgtggac
atctacgtcccaggctgcccgcccacggctgaggccctgctctacggcatcctgcagctg
cagaagaagatcaagcgggagaagaggctccgcatctggtaccgcaggtag

KEGG   Felis catus (domestic cat): 101096614Help
Entry
101096614         CDS       T02385                                 

Gene name
NDUFB6
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 6
  KO
K03962  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096614 (NDUFB6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101096614 (NDUFB6)
  09159 Environmental adaptation
   04714 Thermogenesis
    101096614 (NDUFB6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096614 (NDUFB6)
   05012 Parkinson disease
    101096614 (NDUFB6)
   05016 Huntington disease
    101096614 (NDUFB6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096614 (NDUFB6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: NDUF_B6
Motif
Other DBs
NCBI-GeneID: 101096614
NCBI-ProteinID: XP_003995592
Ensembl: ENSFCAG00000001297
Position
D4
AA seq 128 aa AA seqDB search
MSGYTPDEKLRLQQLRELRRRWLKDQELSPREPVLPPQRVWPMERFWNKFLQDQAPWKKV
IYKAYGHSIFAFTHVLIPAWIIHYYIKYHVNAKPYAIVERKPRIFPGDTILETGEVIPPM
KEFPDQHH
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atgtcgggatacacgcccgatgagaaactgcggctgcagcagctccgagagctgagaagg
cgatggctaaaggaccaagaactgagcccccgggagccggtgctgcccccgcagagggtg
tggcctatggagagattctggaataagtttttgcaggaccaggccccctggaagaaggtg
atttataaggcatatggacacagtatctttgcttttactcatgtacttatacctgcctgg
attattcattattatatcaaatatcatgtgaatgcaaaaccgtatgccattgttgaaagg
aagcccagaatattcccaggtgatacaattctggagactggagaagtaattccaccaatg
aaagaatttcctgatcagcatcactga

KEGG   Felis catus (domestic cat): 101096914Help
Entry
101096914         CDS       T02385                                 

Gene name
NDUFS3
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 3, mitochondrial
  KO
K03936  NADH dehydrogenase (ubiquinone) Fe-S protein 3 [EC:7.1.1.2 1.6.99.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096914 (NDUFS3)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101096914 (NDUFS3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101096914 (NDUFS3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096914 (NDUFS3)
   05012 Parkinson disease
    101096914 (NDUFS3)
   05016 Huntington disease
    101096914 (NDUFS3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096914 (NDUFS3)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101096914 (NDUFS3)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101096914 (NDUFS3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Complex1_30kDa
Motif
Other DBs
NCBI-GeneID: 101096914
NCBI-ProteinID: XP_019667973
Ensembl: ENSFCAG00000009504
UniProt: A0A2I2U833
Position
D1
AA seq 265 aa AA seqDB search
MAATAAAARGWWRGLVGSVALARVAGRPSVLLLPVRRESVAADTRPTVRPRNDVAHKQLS
AFGEYVAEILPKYVQQVQVSCFNELEICIHPDGVIPVLTFLRDHTNAQFKSLADLTAVDV
PTRQNRFEIVYNLLSLRFNSRIHVKTYTDELTPIESTVPVYKAANWYEREIWDMFGVFFA
NHPDLRRILTDYGFEGHPFRKDFPLSGYVELRYDDEVKRVVAEPVELAQEFRKFDLNSPW
EAFPAYRQPPESLKLEAGDKKPETK
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atggccgcgacggcggctgctgcgaggggctggtggcggggtctcgtagggtccgtggcg
ttggccagggtggcggggcgaccctcggtgctgttgctgccggtgaggagggaaagcgtc
gcggcagacacgcgccccactgtccgaccacggaatgatgtggcccacaagcagctctca
gcttttggagagtatgtggctgaaatcctgcccaagtatgtccaacaagttcaggtgtct
tgcttcaatgagttagagatctgtatccatcctgacggagtcatcccagtgctgactttc
ctcagggatcacaccaatgcacagttcaaatccttggctgacttgacagcagtggacgtc
cccacccggcaaaaccgttttgagattgtttacaacctgctctctctgcgcttcaactcc
cggatccatgtgaagacctacacagatgagctgacacccattgagtccactgttcctgtg
tataaggcagctaactggtatgagagggagatctgggacatgtttggagtgttttttgct
aaccatcctgatctaaggaggatcctgacagactatggctttgagggacatcctttccgg
aaagactttcccctatctggctacgttgagttgcgctatgacgatgaggtgaagcgggtg
gtggctgagccagtggaattggcccaggagttccgcaagtttgacctgaacagcccttgg
gaggctttccctgcctatcggcagcctcctgaaagtctcaagctcgaagctggggacaag
aaacctgaaaccaagtag

KEGG   Felis catus (domestic cat): 101097623Help
Entry
101097623         CDS       T02385                                 

Gene name
NDUFB11
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 beta subcomplex subunit 11, mitochondrial
  KO
K11351  NADH dehydrogenase (ubiquinone) 1 beta subcomplex subunit 11
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00147  NADH dehydrogenase (ubiquinone) 1 beta subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101097623 (NDUFB11)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101097623 (NDUFB11)
  09159 Environmental adaptation
   04714 Thermogenesis
    101097623 (NDUFB11)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097623 (NDUFB11)
   05012 Parkinson disease
    101097623 (NDUFB11)
   05016 Huntington disease
    101097623 (NDUFB11)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101097623 (NDUFB11)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ESSS
Motif
Other DBs
NCBI-GeneID: 101097623
NCBI-ProteinID: XP_004000490
Ensembl: ENSFCAG00000028176
UniProt: A0A337SSY0
Position
X
AA seq 154 aa AA seqDB search
MAAGLLVLCARRLSAVAATRGLQAARVRWESSSSRAVIAPSAVAGKRAPAPTVRWQEDPE
PEDENLYEKNPDSHGYDRDPVTDVWNMRVVFFFGFSVVLVLGSTFIAYLPDYRMQEWARR
EAERLVKYREANGLPIMESNCFDPSKIQLPEDED
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcggccgggctgttagttttgtgcgctcgccgcctttcggcagtagcggcgacgcga
gggctccaggccgcccgtgttcgctgggaatccagctcgtccagggctgtgatcgccccg
tcggctgtggcaggaaagcgggcgccggcaccgactgtacgctggcaggaggacccagag
ccggaggacgaaaacctctatgagaagaacccagactcccacggttatgacagagaccct
gttacggacgtctggaacatgcgggtcgtctttttctttggcttctctgttgtcttggtc
ctcggcagcacctttatagcttatctgcctgattacagaatgcaggagtgggcccgccgg
gaagctgagaggcttgttaagtaccgagaggccaatggcctccccatcatggaatccaac
tgctttgaccccagcaagatccagcttccggaggatgaggactga

KEGG   Felis catus (domestic cat): 101099010Help
Entry
101099010         CDS       T02385                                 

Gene name
NDUFAB1
Definition
(RefSeq) acyl carrier protein, mitochondrial
  KO
K03955  NADH dehydrogenase (ubiquinone) 1 alpha/beta subcomplex 1, acyl-carrier protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
fca_M00873  Fatty acid biosynthesis in mitochondria, animals
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101099010 (NDUFAB1)
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    101099010 (NDUFAB1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101099010 (NDUFAB1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101099010 (NDUFAB1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101099010 (NDUFAB1)
   05012 Parkinson disease
    101099010 (NDUFAB1)
   05016 Huntington disease
    101099010 (NDUFAB1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101099010 (NDUFAB1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PP-binding PP-binding_2 MinE
Motif
Other DBs
NCBI-GeneID: 101099010
NCBI-ProteinID: XP_011288921
Ensembl: ENSFCAG00000013241
UniProt: M3WIH4
Position
E3
AA seq 154 aa AA seqDB search
MAARVLSACVRRLPAAFAPLPRVPTLAAVRPLSNTLCPAGARTRPGVPHPASVLAQVPVT
QLCRQYSDAPPLTLEGIKDRVLYVLKLYDKIDPEKLSVNSHFMKDLGLDSLDQVEIIMAM
EDEFGFEIPDTDAEKLMCPQEIVDYIADKKDVYE
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtgtcctttccgcttgtgtccgccgactgcctgcggccttcgcgccgctg
ccccgggtccccacgctggccgcagtccggccgctcagcaacaccctctgccccgcgggg
gcccggacgaggcctggggttccgcatcctgcctcggtgctcgcgcaggtgccagtaacg
cagttgtgccgccagtatagtgatgcgccccctttgacgttagagggaatcaaggaccgt
gttctttatgtcttgaaactctatgacaagatcgaccctgaaaagctctcggtaaattcc
cactttatgaaagacctgggcttagacagtttggaccaagtggagattatcatggccatg
gaggacgaatttgggtttgaaatccctgatacagatgctgagaagttaatgtgtccacaa
gaaattgtagattacattgcagataagaaggatgtttatgaataa

KEGG   Felis catus (domestic cat): 101099952Help
Entry
101099952         CDS       T02385                                 

Gene name
NDUFA4
Definition
(RefSeq) cytochrome c oxidase subunit NDUFA4
  KO
K03948  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101099952 (NDUFA4)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101099952 (NDUFA4)
  09159 Environmental adaptation
   04714 Thermogenesis
    101099952 (NDUFA4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101099952 (NDUFA4)
   05012 Parkinson disease
    101099952 (NDUFA4)
   05016 Huntington disease
    101099952 (NDUFA4)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101099952 (NDUFA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: B12D
Motif
Other DBs
NCBI-GeneID: 101099952
NCBI-ProteinID: XP_003982852
Ensembl: ENSFCAG00000024790
UniProt: A0A2I2UYZ8
Position
A2
AA seq 82 aa AA seqDB search
MLRQIFGQAKKHPSLIPLFIFIGAGGTGAALYVLRLALFNPDVSWDRKNNPEPWNKLGPN
DQYKFYSVNVDYSKLKKEGPDF
NT seq 249 nt NT seq  +upstreamnt  +downstreamnt
atgttacgccagatcttcggtcaggccaagaagcatccgagcttgatccccctcttcata
tttattggagcgggaggtactggagcagcactatatgtcttgcgcctggcattgttcaat
ccagatgtcagttgggataggaagaataacccagaaccttggaacaaattgggtcccaat
gatcaatacaagttctactcagtgaatgtagattacagcaaactgaagaaagaaggtcca
gacttctaa

KEGG   Felis catus (domestic cat): 101100189Help
Entry
101100189         CDS       T02385                                 

Gene name
NDUFA13
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] 1 alpha subcomplex subunit 13
  KO
K11353  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex subunit 13
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00146  NADH dehydrogenase (ubiquinone) 1 alpha subcomplex
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101100189 (NDUFA13)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101100189 (NDUFA13)
  09159 Environmental adaptation
   04714 Thermogenesis
    101100189 (NDUFA13)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101100189 (NDUFA13)
   05012 Parkinson disease
    101100189 (NDUFA13)
   05016 Huntington disease
    101100189 (NDUFA13)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101100189 (NDUFA13)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GRIM-19 COX14
Motif
Other DBs
NCBI-GeneID: 101100189
NCBI-ProteinID: XP_003982173
Position
A2
AA seq 144 aa AA seqDB search
MAASKVKQDMPPPGGYGPIDYKRNLPRRGLSGYSMFAVGIGTLLFGYWSMMKWNRERRRL
QIEDFEARIALMPLLQAEKDRRVLQMLRENLEEEAIIMKDVPDWKVGESVFHTTRWVNPI
MGELYGLRTNEEILNAAYGFMWYT
NT seq 435 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgtcgaaggtgaagcaggacatgcccccgccggggggctatggccccattgac
tacaagcggaaccttccacgtcggggactgtcgggctacagcatgtttgctgtgggcatc
gggaccttgctgtttgggtactggagcatgatgaagtggaaccgagagcggaggcgcctg
cagattgaggacttcgaggcccgcattgcgttgatgccactgttgcaggcagagaaggat
cggagggttctgcagatgcttcgggagaacctggaggaggaggccatcatcatgaaggac
gtgcctgactggaaggtgggtgagtctgtgttccacacaacgcgctgggtgaaccccata
atgggcgagctctacgggctgcgcacgaacgaggagattctcaacgccgcctacggcttc
atgtggtacacatag

KEGG   Felis catus (domestic cat): 101100747Help
Entry
101100747         CDS       T02385                                 

Gene name
NDUFS1
Definition
(RefSeq) NADH-ubiquinone oxidoreductase 75 kDa subunit, mitochondrial
  KO
K03934  NADH dehydrogenase (ubiquinone) Fe-S protein 1 [EC:7.1.1.2 1.6.99.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101100747 (NDUFS1)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101100747 (NDUFS1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101100747 (NDUFS1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101100747 (NDUFS1)
   05012 Parkinson disease
    101100747 (NDUFS1)
   05016 Huntington disease
    101100747 (NDUFS1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101100747 (NDUFS1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.99  With unknown physiological acceptors
    1.6.99.3  NADH dehydrogenase
     101100747 (NDUFS1)
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.1  Linked to oxidoreductase reactions
    7.1.1.2  NADH:ubiquinone reductase (H+-translocating)
     101100747 (NDUFS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Molybdopterin Fer2_4 NADH-G_4Fe-4S_3 NADH_dhqG_C Fer2
Motif
Other DBs
NCBI-GeneID: 101100747
NCBI-ProteinID: XP_003991092
Ensembl: ENSFCAG00000023344
UniProt: M3WWI9
Position
C1
AA seq 727 aa AA seqDB search
MLRIPLKRALVGLSKSHKGCVRTTATAASNLIEVFVDGQSVMVEPGTTVLQACEKVGMQI
PRFCYHERLSVAGNCRMCLVEIEKAPKVVAACAMPVMKGWNILTNSEKSKKAREGVMEFL
LANHPLDCPICDQGGECDLQDQSMMFGNDRSRFLDGKRAVEDKNIGPLVKTIMTRCIQCT
RCIRFASEIAGVDDLGTTGRGNDMQVGTYIEKMFMSELSGNIIDICPVGALTSKPYAFTA
RPWETRKTESIDVMDAVGSNIVVSTRTGEVMRILPRMHEDINEEWISDKTRFAYDGLKRQ
RLTEPMVRNEKGLLTYTSWEDALSRVAGMLQSVQGKDVAAIAGGLVDAEALVALKDLLNR
VDSDTLCTEEVFPTAGAGTDLRSNYLLNTTIAGVEEADVLLLVGTNPRFEAPLFNARIRK
SWLHNDLKVALIGSPVDLTYRYDHLGDSPKILQEIALGNHPFSQVLHEAKKPMVVLGSSA
LQRNDGAAILAAVSNIAQKIRTSSDVTSDWKVMNILHRIASQVAALDLGYKPGVEAIRKS
PPKVLFLLGADGGCITREDLPKDCFIIYQGHHGDVGAPIADVILPGAAYTEKSATYVNTE
GRAQQTRVAVTPPGLAREDWKIIRALSEIAGMTLPYDTLDQVRNRLEEVSPNLVRYDDVE
GANYFQQANELSKLVNQQLLADPLVPPQLTIKDFYMTDSISRASQTMAKCVKAVTEGAQA
VEEPSVC
NT seq 2184 nt NT seq  +upstreamnt  +downstreamnt
atgttaaggatacctctaaaaagggccttagtaggcctttctaagtctcataaaggatgt
gttcgaacaactgccacagcagcaagcaacttaattgaagtatttgtcgacggtcagtct
gtcatggtggaaccaggaactaccgtactccaagcttgtgagaaggttggcatgcagatc
cctcgattctgttatcatgaaagattgtctgttgctggaaactgtaggatgtgccttgtt
gaaattgagaaagctcctaaggttgtggcggcttgtgccatgccagtaatgaaaggttgg
aatatcctgacaaactcagagaaatctaagaaagcaagagaaggtgtgatggagttcttg
ttagcaaatcacccactggactgtcctatttgtgaccagggaggtgaatgtgatctgcag
gaccagtccatgatgtttggaaatgataggagcagatttttagatgggaaacgtgctgtg
gaggacaagaatattgggccattggtaaagactatcatgactagatgtatacagtgtact
cgctgcatcaggtttgcaagtgagattgcaggagtagatgatttgggaacaacaggcaga
ggaaatgatatgcaagttggcacgtacattgaaaagatgttcatgtctgaactgtctgga
aatatcattgatatctgccccgtaggtgccctgacttcgaagccctatgcttttactgcc
cgcccttgggaaacaaggaagacggaatccattgatgtaatggatgcagttggaagtaat
attgtggtaagcacaagaactggagaggtgatgcggattttgccaaggatgcatgaggac
atcaatgaagagtggatctctgataaaaccagatttgcctatgatgggctaaaacgtcaa
agactaaccgagccaatggtcagaaacgaaaaggggcttttaacctacacttcctgggaa
gatgcactctctcgtgtagctggaatgttgcagagtgttcaaggcaaggatgtggcagca
attgcaggtggcttggtggatgctgaagccctggtagctctcaaagatttgcttaataga
gtggactctgacaccttgtgcactgaagaggtcttccccactgcaggagctggcacagat
ttgcgttctaattatcttcttaatactacaattgctggtgtggaagaggcagatgttctc
cttctggttggtacaaatccgcgttttgaggcaccactgtttaatgctagaattcgaaag
agctggcttcataatgacttaaaagtggcccttattggcagcccagtggatctcacttac
agatatgaccatctgggagattcccccaaaattcttcaggagattgctttgggtaaccat
ccattcagccaggtattacatgaagctaaaaaaccaatggtggttttaggcagttctgca
ctccaaagaaatgatggggcagcaattcttgcagctgtttccaacattgctcaaaagatt
cggacgagtagtgatgttaccagtgattggaaagttatgaatatccttcataggattgca
agccaagtagctgctttggaccttggctataaacctggggtggaagcaattcgtaagagc
cctcccaaagtgctatttctcctgggagcagatggaggttgtatcactcgagaggatttg
ccaaaggattgtttcattatttatcaaggacatcatggagacgttggagctccgatagct
gatgttattctcccaggagctgcttacacagaaaagtcagccacttatgtcaatactgaa
ggccgagctcagcagacaagagtagcagtgacacctcctggcttggcaagagaagactgg
aaaattataagagccctctctgagattgcaggtatgactcttccatatgatactctggat
caagtaaggaacagattggaggaagtctctcctaatcttgtccgatatgatgatgtcgaa
ggagccaattatttccagcaagcaaatgagctctccaagctagtgaaccagcaacttctt
gctgatccgcttgttccacctcagctaacaataaaagacttctacatgacagactcaatt
agcagagcctcacagacaatggccaaatgtgtcaaagctgtcacggaaggtgcccaagca
gtagaggagccatccgtttgctga

KEGG   Felis catus (domestic cat): 101101113Help
Entry
101101113         CDS       T02385                                 

Gene name
NDUFS6
Definition
(RefSeq) NADH dehydrogenase [ubiquinone] iron-sulfur protein 6, mitochondrial
  KO
K03939  NADH dehydrogenase (ubiquinone) Fe-S protein 6
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04714  Thermogenesis
fca04723  Retrograde endocannabinoid signaling
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00143  NADH dehydrogenase (ubiquinone) Fe-S protein/flavoprotein complex, mitochondria
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101101113 (NDUFS6)
 09150 Organismal Systems
  09156 Nervous system
   04723 Retrograde endocannabinoid signaling
    101101113 (NDUFS6)
  09159 Environmental adaptation
   04714 Thermogenesis
    101101113 (NDUFS6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101101113 (NDUFS6)
   05012 Parkinson disease
    101101113 (NDUFS6)
   05016 Huntington disease
    101101113 (NDUFS6)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101101113 (NDUFS6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-CHCC Thiolase_C
Motif
Other DBs
NCBI-GeneID: 101101113
NCBI-ProteinID: XP_023095561
Position
A1
AA seq 125 aa AA seqDB search
MAATVTFCRLLGRSRPAALTLPRGARCLGVRTSPTGEKITHTGQAYDDKDYRKIRFVGRQ
KEVNENFAIDLIAEQPVSGADSRVVACDGGGGALGHPKVYINLDKETKTGTCGYCGLQFR
QQHHH
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgacggtcaccttctgccggctgctgggccggagccgtccggcggcgctgacc
ctgccccgtggcgccaggtgtctaggggtgcggacttcaccgaccggggagaagattacg
cacaccggccaggcttatgatgataaggactacaggaaaatccgatttgtaggtcgccag
aaagaggtgaatgaaaactttgccatcgatttgatagctgagcagcccgtgagtggagct
gacagtcgggtggtcgcgtgtgacggcggcgggggggctcttggccacccaaaagtgtac
ataaacctggacaaggaaaccaaaactgggacgtgcggctattgtggactgcagttcaga
cagcagcatcaccattag

DBGET integrated database retrieval system