KEGG   Felis catus (domestic cat): 101080870Help
Entry
101080870         CDS       T02385                                 

Gene name
CACNA1F
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1F isoform X1
  KO
K04853  voltage-dependent calcium channel L type alpha-1F
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04723  Retrograde endocannabinoid signaling
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101080870 (CACNA1F)
   04020 Calcium signaling pathway
    101080870 (CACNA1F)
   04024 cAMP signaling pathway
    101080870 (CACNA1F)
   04022 cGMP-PKG signaling pathway
    101080870 (CACNA1F)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101080870 (CACNA1F)
   04912 GnRH signaling pathway
    101080870 (CACNA1F)
   04921 Oxytocin signaling pathway
    101080870 (CACNA1F)
   04924 Renin secretion
    101080870 (CACNA1F)
   04925 Aldosterone synthesis and secretion
    101080870 (CACNA1F)
   04927 Cortisol synthesis and secretion
    101080870 (CACNA1F)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101080870 (CACNA1F)
   04261 Adrenergic signaling in cardiomyocytes
    101080870 (CACNA1F)
   04270 Vascular smooth muscle contraction
    101080870 (CACNA1F)
  09156 Nervous system
   04727 GABAergic synapse
    101080870 (CACNA1F)
   04725 Cholinergic synapse
    101080870 (CACNA1F)
   04726 Serotonergic synapse
    101080870 (CACNA1F)
   04723 Retrograde endocannabinoid signaling
    101080870 (CACNA1F)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101080870 (CACNA1F)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101080870 (CACNA1F)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101080870 (CACNA1F)
   05414 Dilated cardiomyopathy (DCM)
    101080870 (CACNA1F)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101080870 (CACNA1F)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101080870 (CACNA1F)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101080870 (CACNA1F)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101080870
NCBI-ProteinID: XP_023105183
Ensembl: ENSFCAG00000003822
Position
X
AA seq 1984 aa AA seqDB search
MSASEGGKDAIPEPSPANGTGPGPEWGLCPGPPASGGEEISGASGLGTPKRRTQHSKHKT
VAVASAQRSPRALFCLTLANPLRRSCISIVEWKPFDILILLTIFANCVALGVYIPFPEDD
SNTANHNLEQVEYVFLVIFTVETVLKIVAYGLVLHPSAYIRNGWNLLDFIIVVVGLFSVL
LEQGPGRPRDTPHTGGKPGGFDVKALRAFRVLRPLRLVSGVPSLHIVLNSIMKALVPLLH
IALLVLFVIIIYAIIGLELFLGRMHKTCYFLGSDVEAEEDPSPCASSGSGRACTLNQTEC
RGRWAGPNGGITNFDNFFFAMLTVFQCVTMEGWTDVLYWMQDAMGYELPWLYFVSLVIFG
SFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLRGYLDWIMQAEELDIEES
SADGNFGSMAEEGRAGHRPQLAELTTRRRGRLRWFSHSTRSTHSTSSHASLPASDTGSMT
ETPGDEEEEEGALAGCTRCLNKIMKTRVCRHLRRANRGLRARCRRAVKSNACYWAVLLLV
FLNTLTIASEHHGQPVWLTQIQEYANKVLLCLFTVEMLLKLYGLGPSAYVSSFFNRFDCF
VVCGGILETTLVEVGAMQPLGISVLRCVRLLRIFKVTRHWASLSNLVASLLNSMKSIASL
LLLLFLFIIIFSLLGMQLFGGKFNFDQTHTKRSTFDTFPQALLTVFQILTGEDWNVVMYD
GIMAYGGPFFPGMLVCIYFIILFICGNYILLNVFLAIAVDNLASGDTGTAKDKGREKSAE
GNPPQENGVLAPGGENEEEEGRKNEGAGMEEEEEEEEEEEEEEEEGAGHVELLQEVVPKE
KVVPIPEGSAFFCLSQTNPLRKACHTLIHHHIFTNLILVFIILSSVSLAAEDPIRAHSFR
NHILGYFDYAFTSIFTVEILLKMTVFGAFLHRGSFCRSWFNLLDLLVVSVSLISFGIHSS
AISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMIVTTLLQFMFACIGVQ
LFKGKFYSCTDEAKHTPQECKGSFLVYPDGDVSRPLVRERLWVNSDFNFDNVLSAMMALF
TVSTFEGWPALLYKAIDANAEDKGPIYNYHVEISVFFIVYIIIIAFFMMNIFVGFVIITF
RAQGEQEYQNCELDKNQRQCVEYALKAQPLRRYIPKNPHQYRVWAAVNSAAFEYLMFLLI
LLNTVALAMQHYEQTAPFNYAMDILNMVFTGLFTVEMVLKIIAFKPKHYFADAWNTFDAL
IVVGSVVDIAVTEVNNGGHLGESSEDSSRISITFFRLFRVMRLVKLLSKGEGIRTLLWTF
IKSFQALPYVALLIAMIFFIYAVIGMQMFGKVALQDGTQINRNNNFQTFPQAVLLLFRCA
TGEAWQEIMLASLPGSRCDPESDISPGEEFTCGSNFAIAYFISFFMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKRIWSEYDPGAKGRIKHLDVVALLRRIQPPLGFGKLCP
HRVACKRLVAMNMPLNSDGTVTFNATLFALVRTSLKIKTEGNLEQANQELRIVIKKIWKR
MKQKLLDEVIPPADEEEVTVGKFYATFLIQDYFRKFRRRKEKGLLGSEAPSSTSSALQAG
LRSLQNLGPEIRQALTCDTDEEEEEEGQEGEEEEDKKDPETYTAPTGSQPPSRRSSVISV
SLPVGDRLPDSLSLGPSDDDGGTPNSRQSSVPQAGSHGHRRSSGGFIFTIPEEESSQPKG
TKEQENQNEEEEVPAKDSGHDMLSYLDEQAGTPLRPILLPPHRPQRYVDGHNAPRRRLLP
PTPAGRKPSFTIQCLRRQGSCEDLPIPGTYHRGRNSGPSRAQGSWATPPQRGRLLYAPLL
LVEEGAAGEGYLGKSSGPLRTFTCLHVPGTHSDSSHGKRGSADSLVEAVLISEGLGLFAR
DPRFVALAKQEIADACRLTLDEMDSAASDLLAQGTSSLYSDEESILSRLDEEDLGDEMAC
VHAL
NT seq 5955 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcatctgaaggcgggaaagacgccatcccagagcccagtccagccaatgggaca
ggccctggtcctgaatgggggctgtgccctgggcctccagcatcagggggtgaagaaatc
agcggggcatcaggcctggggacccctaagcgaaggactcagcacagtaagcacaagaca
gtggcagtggccagtgcccagcggtcaccccgagcgctcttctgcctcactctggccaac
cccctgcggcggtcctgcatcagcattgtggagtggaagcccttcgacatcctcatcctg
ctgaccatctttgccaactgtgtagccctgggggtctacatccccttcccagaggatgac
tccaacactgccaaccacaacctggagcaagtggagtacgtattcctggtgatttttact
gtggagactgtgctcaagatcgtggcctatgggctggtgctccatcccagcgcctacatc
cgcaatggctggaacctactcgacttcatcatcgttgtggtcgggctgtttagcgtgcta
ctggagcagggccctggtcggccgagagacaccccacataccggggggaagccggggggc
ttcgatgtgaaggcgttgagggcttttcgggtgctgcggccactgaggctggtgtctggg
gtcccaagcctgcacatcgtgcttaattccatcatgaaggcgctggtgccactactgcac
atcgcactgctcgtgctgttcgtcatcatcatttatgccatcatcggactcgaactgttc
cttggacgaatgcacaagacatgttacttcctgggatctgacgtggaagcggaggaggac
ccgtcgccctgtgcgtcttctggctcggggcgtgcatgcacactgaaccagaccgagtgc
cgcgggcgctgggcagggcccaacggaggcatcaccaatttcgacaacttcttcttcgcc
atgctgacggtcttccagtgcgtcaccatggaaggctggacagatgtgctctactggatg
caggatgccatggggtatgagctgccctggttatatttcgtgagtctcgtcatctttggg
tccttcttcgtcctcaaccttgtgcttggtgtcctgagtggagagttctccaaggagagg
gagaaggcaaaagcacgaggggacttccagaagcttcgggagaagcagcagttggaggag
gacctccggggctacctggactggatcatgcaggcagaggagctggacatcgaagagtcc
tcagctgatggcaactttggttctatggctgaagagggccgggctggccaccggccacaa
ctggcagagctaaccactaggagacgtggacgtctgcgctggttcagtcactccacccgc
tccacacactccaccagcagccacgccagcctcccagccagtgacactggttcgatgaca
gagaccccaggcgatgaggaagaggaggagggggctctggccggttgtacacgctgccta
aacaagatcatgaaaaccagggtctgccgccacctccgcagagccaatcggggccttcgg
gcacgctgccggcgggcggtgaagtccaatgcctgttactgggccgtgctgctgctcgtc
ttcctcaacacactgaccatcgcctcagagcaccacggacagcccgtatggctcacgcag
atccaggagtatgccaacaaagtgttgctctgtctgttcacggtggagatgcttctcaag
ttgtacggtcttggcccctctgcttatgtttcttctttcttcaaccgctttgactgcttt
gtggtctgtgggggcatcctggagaccaccctggtggaggtgggcgccatgcagcccctg
ggcatctcagtgctccgatgtgtgcgcctcctcaggatctttaaggtcactaggcactgg
gcatctctgagcaatttggtggcatccctgctcaattcaatgaaatccatcgcatcgttg
ctgcttcttctcttcctctttatcataatcttctccctgcttggcatgcagctgtttggg
ggcaagttcaactttgatcagacccacaccaagcgaagcaccttcgataccttcccccag
gccctcctcactgtctttcagatcctgacaggtgaggattggaacgtggtcatgtacgat
ggtatcatggcctatggtggcccctttttcccaggaatgctggtctgcatctacttcatc
atcctcttcatctgcggcaactatatccttttgaacgtgtttctcgccattgctgtggat
aacctggccagtggagacacaggaactgccaaagacaagggcagggagaagagtgctgag
gggaatcccccacaggaaaatggagtattggcacctggtggggagaatgaggaagaggag
ggcagaaagaatgaaggagcaggcatggaggaagaagaggaggaggaggaggaagaggaa
gaagaggaggaagaaggtgcagggcatgtggaactcctgcaagaagttgtacccaaggag
aaggtggtacccatccctgagggcagtgccttcttctgtctcagccaaacgaacccgctg
aggaaggcctgccacaccctcatccaccatcatatcttcaccaatcttatcctggtgttc
atcatcctcagcagcgtgtccctggccgctgaggaccccatccgagcccactccttccgc
aaccacattctagggtacttcgattatgctttcacctccattttcactgtggagatttta
ctaaagatgacagtgtttggggccttcctgcaccgaggctctttctgccgtagctggttc
aacctgttggatctgctggtggtcagcgtgtccctcatctcctttggtatccactccagt
gccatctcagtggtgaagattctgagagtcctccgagtactgaggcctctccgagccatc
aacagggccaagggactcaagcacgtggtgcagtgtgtgttcgtggctatccggaccatc
gggaatatcatgattgtgaccacactcctgcaattcatgtttgcctgcattggcgtgcag
ctcttcaaggggaaattctacagttgcactgatgaggccaaacacaccccccaagaatgc
aagggctccttcctggtctaccctgatggagatgtatcacggcccctcgtccgggagcgg
ctctgggtcaacagcgatttcaacttcgacaatgtcctttcagccatgatggccttgttc
actgtctccaccttcgaaggctggcctgctctactatataaggccatcgatgcaaacgca
gaggacaagggccctatctataattaccacgtggagatctcagtgttcttcattgtctac
atcatcatcattgcattcttcatgatgaacatctttgtgggttttgtcatcattactttc
cgtgcccaaggcgagcaagagtaccaaaactgtgagctggacaagaaccagcgccagtgt
gtggagtatgccctcaaggcccagccactccgccgctacatccccaagaacccacatcag
tatcgcgtgtgggcagctgtgaactctgctgccttcgagtatctcatgttcctgctcatc
ctgctcaacaccgttgctctagccatgcagcactatgaacagactgctccctttaactac
gccatggacatcctcaacatggtcttcactggccttttcactgttgagatggtgctcaaa
atcattgccttcaaacccaagcattactttgctgatgcctggaacacgtttgatgctctt
attgtggtgggcagcgtagtggacattgccgtcactgaagtcaataatggtggccacctt
ggcgagagctctgaagacagttctcgcatttccatcaccttctttcgcctcttccgagtc
atgcggctagtgaagcttctcagtaaaggtgaaggaatccgcacattgctctggacattc
atcaagtccttccaggccttgccctatgtggctcttctcatcgcgatgatattctttatt
tatgcagtcattgggatgcagatgtttggtaaagtggctcttcaagatggcacacagatc
aaccgaaacaacaattttcagacctttccacaggctgtgctacttttgttcaggtgtgcc
accggtgaggcatggcaggagataatgcttgccagccttcctgggagtcggtgtgaccct
gagtctgacatcagccctggtgaggagtttacctgtggcagcaattttgccatcgcctat
tttatcagtttcttcatgctctgtgccttcctgatcataaatctctttgtggctgtcatc
atggacaactttgattatctaaccagagattggtccatcctgggcccccatcacctcgat
gaattcaagaggatctggtctgaatatgaccctggagccaagggccgcatcaagcacctg
gacgtggttgccctgctgagacggatccagccccccttgggatttgggaagctgtgccca
caccgagtggcctgcaagagacttgtggcgatgaacatgcccctcaactcagatgggaca
gtgacattcaatgccacactctttgccctggttcggacatccttgaagatcaagacagaa
gggaacctggaacaagccaatcaggagctgcggattgtcatcaaaaagatctggaagcgg
atgaagcagaagctgctagatgaagtcatcccccctgctgacgaggaagaggtcaccgta
ggcaaattctacgccacatttctgatccaggactatttccgcaaattcaggcggaggaag
gagaaggggctactagggagcgaggccccctcaagcacttcctctgctcttcaggctggt
ctaaggagcctacagaacttgggtcctgagatccggcaggccctcacctgtgacacagat
gaagaggaggaggaagaggggcaggagggagaggaagaggaagataagaaggatccagaa
acatacacagccccaacgggctcccagcccccatctcgccggagttctgtgatttctgta
tctctgcctgttggggacagacttccagattcactctcccttgggcccagtgacgatgat
ggggggactcccaattccagacagtccagtgtgccccaggctggatcccatggccacagg
agaagctctggggggttcattttcaccattccagaagaagaaagttctcagcccaaggga
acgaaagagcaagagaatcagaatgaggaagaggaagtccccgccaaggactctggccat
gacatgctctcctacctagatgagcaggcagggactcccctgcgccccatccttttgcca
cctcacagaccccagagatatgtggatggccacaatgcaccacgccgccgtctgctgccc
cccacacctgcaggtcggaagccttccttcactatccagtgtctgcggcgccagggcagt
tgtgaagatttacccatcccaggcacctatcatcgtgggcgcaactcgggccccagcagg
gcgcagggttcctgggcaacccctcctcagcggggtcggctcctatatgccccactgtta
ttggtggaggagggtgcagcgggggaggggtacctcggcaaatccagtggtccactgcgc
accttcacctgtctgcatgtgcctggaacccactcagactccagccatggcaagaggggc
agtgctgacagcctggtggaggctgtgctcatctctgagggcctgggcctctttgcccga
gacccacgctttgtggccctggccaagcaggagattgcagatgcgtgtcgcctgacactg
gacgagatggacagtgctgccagtgatctgctggcacaggggaccagctcactctatagt
gatgaggaatccatcctctctcgcttagatgaggaggacctgggagacgaaatggcctgt
gtccatgccctctga

KEGG   Felis catus (domestic cat): 101082923Help
Entry
101082923         CDS       T02385                                 

Gene name
CACNA1C
Definition
(RefSeq) LOW QUALITY PROTEIN: voltage-dependent L-type calcium channel subunit alpha-1C
  KO
K04850  voltage-dependent calcium channel L type alpha-1C
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04713  Circadian entrainment
fca04720  Long-term potentiation
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04742  Taste transduction
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04930  Type II diabetes mellitus
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05031  Amphetamine addiction
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082923 (CACNA1C)
   04020 Calcium signaling pathway
    101082923 (CACNA1C)
   04024 cAMP signaling pathway
    101082923 (CACNA1C)
   04022 cGMP-PKG signaling pathway
    101082923 (CACNA1C)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101082923 (CACNA1C)
   04912 GnRH signaling pathway
    101082923 (CACNA1C)
   04921 Oxytocin signaling pathway
    101082923 (CACNA1C)
   04924 Renin secretion
    101082923 (CACNA1C)
   04925 Aldosterone synthesis and secretion
    101082923 (CACNA1C)
   04927 Cortisol synthesis and secretion
    101082923 (CACNA1C)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101082923 (CACNA1C)
   04261 Adrenergic signaling in cardiomyocytes
    101082923 (CACNA1C)
   04270 Vascular smooth muscle contraction
    101082923 (CACNA1C)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082923 (CACNA1C)
   04727 GABAergic synapse
    101082923 (CACNA1C)
   04725 Cholinergic synapse
    101082923 (CACNA1C)
   04728 Dopaminergic synapse
    101082923 (CACNA1C)
   04726 Serotonergic synapse
    101082923 (CACNA1C)
   04720 Long-term potentiation
    101082923 (CACNA1C)
   04723 Retrograde endocannabinoid signaling
    101082923 (CACNA1C)
  09157 Sensory system
   04742 Taste transduction
    101082923 (CACNA1C)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101082923 (CACNA1C)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101082923 (CACNA1C)
  09165 Substance dependence
   05031 Amphetamine addiction
    101082923 (CACNA1C)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101082923 (CACNA1C)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101082923 (CACNA1C)
   05414 Dilated cardiomyopathy (DCM)
    101082923 (CACNA1C)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101082923 (CACNA1C)
   04934 Cushing syndrome
    101082923 (CACNA1C)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101082923 (CACNA1C)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101082923 (CACNA1C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel
Motif
Other DBs
NCBI-GeneID: 101082923
NCBI-ProteinID: XP_023112367
Ensembl: ENSFCAG00000008541
Position
B4
AA seq 2227 aa AA seqDB search
MLRAFVQPAAPAYQPLPRHPSAESEAKFKGTLVHEAQLNCFYIPPGGSNYGSPRAAHANM
NANAAAGLAPEHIPTPGAALSWQAAIDAARQAKLMGSAGNATISTISSTQRKRQQYGKPK
KQGSTTATRPPRALLCLTLKNPIRRACISIVEWKPFEIIILLTIFANCVALAIYIPFPED
DSNATNSNLERVEYLFLIIFTVEAFLKVIAYGLLFHPNAYLRNGWNLLDFIIVVVGLFSA
ILEQATKADGANALGGKGAGFDVKALRAFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLH
IALLVLFVIIIYAIIGLELFMGKMHKTCYNQEGIADVPAEDDPSPCALETGHGRQCQNGT
VCKPGWDGPKHGITNFDNFAFAMLTVFQCITMEGWTDVLYWVNDAVGRDWPWIYFVTLII
IGSFFVLNLVLGVLSGEFSKEREKAKARGDFQKLREKQQLEEDLKGYLDWITQAEDIDPE
NEDEGMDEEKPRNMSMPTSETESVNTENVAGGDIEGENCGARLAHRISKSKFSRYWRRWN
RFCRRKCRAAVKSNVFYWLVIFLVFLNTLTIASEHYNQPHWLTEVQDTANKALLALFTAE
MLLKMYSLGLQAYFVSLFNRFDCFIVCGGILETILVETKIMSPLGISVLRCVRLLRIFKI
TRYWNSLSNLVASLLNSVRSIASLLLLLFLFIIIFSLLGMQLFGGKFNFDEMQTRRSTFD
NFPQSLLTVFQILTGEDWNSVMYDGIMAYGGPSFPGMLVCIYFIILFICGNYILLNVFLA
IAVDNLADAESLTSAQKEEEEEKERKKLARTASPEKKQEIMEKPAVEETKEEKIELKSIT
ADGESPPTTKINMDDLQPNENEDKSPYPNPENTGEDDEEEPEMPVGPRPRPLSELHLKEK
AVPMPEASAFFIFSPNNRFRLQCHRIVNDTIFTNLILFFILLSSISLAAEDPVQHTSFRN
HILFYFDIVFTTIFTIEIALKILGNADYVFTSIFTLEIILKMTAYGXFLHKGSFCRNYFN
ILDLLVVSVSLISFGIQSSAINVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIG
NIVIVTTLLQFMFACIGVQLFKGKLYTCSDSSKQTEAECKGNYITYKDGEVDHPIIQPRS
WENSKFDFDNVLAAMMALFTVSTFEGWPELLYRSIDSHTEDKGPIYNYRVEISIFFIIYI
IIIAFFMMNIFVGFVIVTFQEQGEQEYKNCELDKNQRQCVEYALKARPLRRYIPKNQHQY
KVWYVVNSTYFEYLMFVLILLNTICLAMQHYGQSCLFKIAMNILNMLFTGLFTVEMILKL
IAFKPKGYFSDPWNVFDFLIVIGSIIDVILSETNHYFCDAWNTFDALIVVGSIVDIAITE
VNPAEHTQCSPFMNAEENSRISITFFRLFRVMRLVKLLSRGEGIRTLLWTFIKSFQALPY
VALLIVMLFFIYAVIGMQVFGKIALNDTTEINRNNNFQTFPQAVLLLFRCATGEAWQDIM
LACMPGKKCAPESEPSNSTEGETPCGSSFAVFYFISFYMLCAFLIINLFVAVIMDNFDYL
TRDWSILGPHHLDEFKRIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKLCPHRVACKR
LVSMNMPLNSDGTVMFNATLFALVRTALRIKTEGNLEQANEELRAIIKKIWKRTSMKLLD
QVVPPAGDDEVTVGKFYATFLIQEYFRKFKKRKEQGLVGKPSQRNALSLQAGLRTLHDIG
PEIRRAISGDLTAEEELDKAMKEAVSAASEDDIFRRAGGLFGNHVSYYQSDGRSAFPQTF
TTQRPLHINKAGNSQGDTESPSHEKLVDSTFTPSSYSSTGSNANINNANNTALGRFPRPA
GYPSAVSTVEGHGPPLSPAVRVQEAAWKLSSKRTHCYDVLGRCHSRESQIAMVCQEEVSQ
DETYDVKISEDTEYCSEPSLISTEMLSYQDDENRQLTPPEEDKRDIRQSPKRGFLRSASL
GRRASFHLECLKRQKNQGGDISQKTVLPLHLVHHQALAVAGLSPLLQRSHSPSTSPRPCA
TPPATPGSRGWPPQPIPTLRLEGAESNEKLNSSFPSIHCSSWSGEPTPCGGGGSTIRRAR
PVSLTVPGQAGAQGRQFHGSASSLVEAVLISEGLGQFAQDPKFIEVTTQELADACDMTIE
EMENAADNILSGGAQQSPNGTLLPFVNCRDPGQDRAEGQEGETCAPTLACRKSEEELQDS
RAHVGSL
NT seq 6684 nt NT seq  +upstreamnt  +downstreamnt
atgcttcgagcctttgttcagcctgctgcgcctgcataccagccgcttcccaggcaccct
tctgccgagtcagaggcgaagtttaagggcactttggtgcatgaagctcaactcaactgt
ttctacatccctcctggaggttccaactatgggagcccgcgtgcagctcacgccaacatg
aatgccaatgcggctgcggggctcgcccccgagcacatcccaacgcccggggcagccttg
tcctggcaggcagccatcgacgcggcccggcaggctaagctgatgggcagcgctggcaat
gcaaccatctccaccatcagctccacacagcggaagcggcagcaatatgggaaacccaag
aagcagggcagcacgactgccacacgcccgccccgtgccctgctctgcctgactctgaag
aaccccatcaggagggcgtgcatcagcatcgtcgaatggaaaccatttgaaataattatt
ttactgactatttttgccaattgtgtggccttagcgatctatattccctttccagaagat
gactccaatgccaccaattccaacctggaacgagtggaatatctctttctcataattttt
actgtggaagcatttttaaaagtaatagcctatggacttctctttcaccccaacgcttac
ctccgcaatggctggaatttactagattttataattgtggttgtagggctttttagtgca
attttagaacaagccaccaaagctgatggggcaaatgctctaggaggtaaaggagctgga
tttgatgtgaaggcactgagggcattccgcgtgctgcgccccttgcggctggtgtctgga
gtcccaagtctccaagtcgttctgaattccattatcaaggccatggtccccctgctgcat
attgccctgttagtgctatttgtcatcatcatctacgctatcattggcctggagctcttc
atgggaaagatgcataagacctgctacaaccaggagggcatagcagatgttccagcagaa
gatgatccttccccttgtgctctggagactggccatgggcggcagtgccagaatggcact
gtgtgcaagcctggctgggacgggcccaagcacggcatcaccaactttgacaattttgcc
ttcgccatgttgacagtgttccagtgcatcaccatggagggctggacagatgtgctatac
tgggtcaatgatgccgtaggaagggactggccctggatctattttgttacacttatcatc
atagggtcattttttgtacttaacttggttctcggtgttcttagcggagagttttccaaa
gagagagagaaggccaaggctcggggagacttccagaagctgcgagagaagcagcagctg
gaagaggacctgaagggctacctggactggatcacccaggcagaggacatcgaccctgag
aacgaggacgaaggcatggatgaggagaagccccgaaacatgagcatgcccacaagtgag
accgagtctgtcaacaccgaaaacgtggctggaggtgacatcgagggagagaactgcggg
gccaggctggcccatcggatttccaaatcaaagttcagccgctactggcgtcggtggaat
cggttctgcagaagaaagtgtcgtgctgcagtcaagtctaatgtcttctactggcttgtg
atcttcctggtgttcctcaacacactcaccattgcctcagaacattacaaccagccccac
tggctcacggaggtccaagacacggccaacaaggcactactggcccttttcactgcggag
atgctgctaaagatgtacagcctgggcctgcaggcctactttgtgtccctcttcaaccgc
tttgactgcttcatcgtgtgtgggggcattctggagaccatcctggtggagaccaagatc
atgtctcccttgggcatctctgtgctgagatgtgtccggctactgcggatatttaaaatc
acaaggtactggaactccttaagcaacctggtggcatccttgctgaattctgtgcgctcc
attgcctccctgctgctactcctcttcctcttcatcatcatcttctccctcctggggatg
cagctctttggaggaaagttcaactttgatgagatgcagactcggaggagcacatttgat
aactttcctcagtccctcctcaccgtgtttcagatcctgaccggggaggactggaattcg
gtgatgtatgatgggatcatggcttatggcggcccctcttttccagggatgttagtctgt
atttacttcatcatcctcttcatctgtggaaactatatcctactgaatgtgttcttggcc
attgctgtggacaacctggctgatgctgagagcctcacatctgcccaaaaggaggaggaa
gaagagaaggagagaaagaagctggccaggactgccagcccagagaagaagcaagagata
atggaaaagccagctgtggaggaaaccaaggaggagaaaattgagctgaaatccattaca
gctgatggagagtccccacccaccaccaagatcaacatggatgacctccagcccaatgaa
aatgaagataagagtccctaccccaacccagaaaatacaggagaagacgatgaagaggag
cctgagatgcctgtgggcccccgcccacgaccactctctgagctgcaccttaaggaaaag
gcagtgcccatgccagaagccagtgcatttttcatcttcagccccaacaacagatttcgc
ctccagtgccaccgcattgtcaatgacacgatcttcaccaacctgatcctcttcttcatt
ctgctcagcagcatttccctggcagctgaggaccctgtccagcacacctccttcaggaac
catattctgttttattttgacattgttttcactaccattttcaccattgaaattgctctg
aagatcctaggcaatgcagactatgtcttcactagtatctttacattagaaattatcctt
aagatgactgcttatgggngctttctacacaagggctctttctgccggaactacttcaac
atcttggacctgctggtggtcagcgtgtccctcatttcctttggcatccagtccagtgca
attaatgtggtgaagatcttgcgagttctgcgagtcctcaggcccctgagggccatcaac
agggccaaggggctaaagcacgtggtccagtgcgtgtttgtcgccatccggaccataggg
aatatcgtgattgtcaccacgctgctccagttcatgttcgcctgcatcggggtccagctt
ttcaagggaaagctctacacctgttcagatagttccaagcagaccgaggcggaatgcaag
ggtaactacatcacatacaaggatggggaagttgaccaccccatcatccagcctcgcagc
tgggaaaacagcaagtttgactttgacaatgttctggcagccatgatggccctctttacc
gtctccacctttgaggggtggccagagctgctgtaccgctccatcgactcccacacagaa
gacaagggccccatctacaactaccgtgtggagatctccatctttttcatcatctacatc
atcatcattgccttcttcatgatgaacatcttcgtgggttttgtcatcgtcaccttccag
gagcagggggagcaggaatacaagaactgtgaactggacaagaaccagcgacagtgtgtg
gaatatgccctcaaggcccggcccctgcggaggtacatccccaaaaaccagcaccagtac
aaagtgtggtacgtggtcaactccacctactttgaatacctgatgttcgtcctcatcctg
ctcaacaccatctgcttggcaatgcagcactatggccagagctgcctattcaaaatcgcc
atgaacatcctcaacatgctcttcactggcctcttcactgtggagatgattctgaagctc
attgccttcaaacccaagggttactttagtgatccctggaatgtttttgacttcctcatc
gtaattggcagcataattgacgtcattctcagtgaaactaatcactatttctgtgatgca
tggaatacatttgacgccttgattgttgtgggtagcattgttgatatagcaatcaccgag
gtaaacccagctgaacatacccaatgctctccctttatgaacgcagaggagaactcccgc
atctccatcaccttcttccgcctcttccgggtcatgcgactggtcaagctgctaagccgt
ggggagggcatccggaccctgctgtggaccttcatcaagtccttccaggctttgccctat
gtggcccttctgatagtgatgctgttcttcatctacgcagtgatcgggatgcaggtgttt
gggaaaattgccctgaatgacaccacagagatcaaccggaacaacaactttcagaccttc
ccccaagctgtgctccttctcttcaggtgtgccacaggggaggcatggcaagacatcatg
ctggcctgcatgccagggaagaagtgtgcccccgagtcagagcccagcaacagcacggaa
ggggaaacgccctgtggcagcagttttgccgtcttctacttcatcagcttctacatgctc
tgtgccttcctgatcatcaacctctttgtagctgtcatcatggacaactttgactacctg
acaagagactggtcaatccttggtccccatcatctggatgaatttaaaagaatctgggca
gagtatgatcctgaagctaagggtcgtatcaaacacctagatgtggtgaccctgctccgg
cggattcagcccccactgggttttgggaagctgtgccctcaccgcgtggcttgcaaacgc
ctggtctccatgaacatgcctctgaacagtgatgggactgtcatgttcaatgccaccctg
tttgccctagtccggacagccctgcggatcaaaacagaagggaacctagaacaagccaat
gaggagctgcgggccataatcaagaagatctggaagcgtaccagcatgaagctgctagac
caagtggtgccccctgcaggtgatgatgaggtcaccgttggcaagttttatgctactttc
ctgatccaagagtacttccggaaattcaagaagcgcaaagagcagggccttgtgggcaag
ccttcccaaaggaatgccctgtccttgcaggctggcttgcgcacgctgcatgacattggg
cctgagatccgacgggccatctctggagatctgacagctgaggaggagctggacaaggcc
atgaaggaggctgtgtctgctgcctccgaagatgacatcttcaggagggccggtggcctg
ttcggcaaccacgtcagctactaccaaagcgacggccggagcgccttcccccagaccttc
accacccagcgcccactgcacatcaacaaggcgggtaacagccaaggcgacaccgagtcg
ccatcccacgagaaactggtggactccaccttcacccccagcagctactcgtccactggc
tccaacgccaacatcaacaatgccaacaacactgccctgggccgcttcccccgtcccgct
ggctaccccagcgcagtcagcaccgtggagggccatgggccccccttgtctcctgctgtc
cgggtacaggaggcagcatggaagctcagctccaagaggacacattgctatgatgtgctg
ggacggtgccactcccgggagagccagatagccatggtgtgtcaggaggaggtctctcag
gacgagacctatgacgtgaagataagtgaagacactgagtactgcagcgagcccagcctg
atctccacagagatgctctcctatcaggatgatgaaaatcggcaattaacaccaccggag
gaggacaagagagatatccggcaatctccaaagaggggcttcctccgctctgcctcacta
ggtcgaagggcctccttccacctggaatgtctgaagcgacagaagaatcaagggggagac
atctctcagaagacagtcctgcccttgcatctggttcatcatcaggcattggcggtggca
ggcctgagccccctcctccagagaagccattcccccagcacatcccccaggccctgtgcc
accccaccagccactccaggcagccgaggctggcccccacagcctatccccaccctgcgg
ctggagggtgccgaatccaacgagaaactcaacagcagcttcccgtccatccactgcagc
tcctggtctggggagcccacaccctgtggtggaggtggcagcaccatccggagagcccgg
ccagtgtccctcactgtgcccggccaggctggggcccagggcaggcagttccacggcagt
gccagcagcctggtagaagcggtcttgatttcagaaggactggggcagtttgctcaagat
cccaagtttattgaggtcacaacccaggagctggctgacgcctgtgacatgaccatagag
gagatggagaacgccgcagacaacatcctcagtgggggcgcccagcagagccccaatggc
accctactacctttcgttaactgcagggacccagggcaggacagagcagagggccaagag
ggcgagacctgcgcgcccaccctggcgtgtcggaagagcgaggaggagctccaggacagc
agagcccacgtcggcagcctgtag

KEGG   Felis catus (domestic cat): 101088394Help
Entry
101088394         CDS       T02385                                 

Gene name
CACNA1D
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1D isoform X12
  KO
K04851  voltage-dependent calcium channel L type alpha-1D
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04218  Cellular senescence
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04530  Tight junction
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04930  Type II diabetes mellitus
fca04934  Cushing syndrome
fca04973  Carbohydrate digestion and absorption
fca05010  Alzheimer disease
fca05031  Amphetamine addiction
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101088394 (CACNA1D)
   04020 Calcium signaling pathway
    101088394 (CACNA1D)
   04024 cAMP signaling pathway
    101088394 (CACNA1D)
   04022 cGMP-PKG signaling pathway
    101088394 (CACNA1D)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101088394 (CACNA1D)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101088394 (CACNA1D)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101088394 (CACNA1D)
   04912 GnRH signaling pathway
    101088394 (CACNA1D)
   04921 Oxytocin signaling pathway
    101088394 (CACNA1D)
   04924 Renin secretion
    101088394 (CACNA1D)
   04925 Aldosterone synthesis and secretion
    101088394 (CACNA1D)
   04927 Cortisol synthesis and secretion
    101088394 (CACNA1D)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101088394 (CACNA1D)
   04261 Adrenergic signaling in cardiomyocytes
    101088394 (CACNA1D)
   04270 Vascular smooth muscle contraction
    101088394 (CACNA1D)
  09154 Digestive system
   04973 Carbohydrate digestion and absorption
    101088394 (CACNA1D)
  09156 Nervous system
   04724 Glutamatergic synapse
    101088394 (CACNA1D)
   04727 GABAergic synapse
    101088394 (CACNA1D)
   04725 Cholinergic synapse
    101088394 (CACNA1D)
   04728 Dopaminergic synapse
    101088394 (CACNA1D)
   04726 Serotonergic synapse
    101088394 (CACNA1D)
   04723 Retrograde endocannabinoid signaling
    101088394 (CACNA1D)
  09159 Environmental adaptation
   04713 Circadian entrainment
    101088394 (CACNA1D)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101088394 (CACNA1D)
  09165 Substance dependence
   05031 Amphetamine addiction
    101088394 (CACNA1D)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    101088394 (CACNA1D)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    101088394 (CACNA1D)
   05414 Dilated cardiomyopathy (DCM)
    101088394 (CACNA1D)
  09167 Endocrine and metabolic disease
   04930 Type II diabetes mellitus
    101088394 (CACNA1D)
   04934 Cushing syndrome
    101088394 (CACNA1D)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101088394 (CACNA1D)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   101088394 (CACNA1D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans CAC1F_C Ca_chan_IQ GPHH PKD_channel Rer1
Motif
Other DBs
NCBI-GeneID: 101088394
NCBI-ProteinID: XP_003982377
Ensembl: ENSFCAG00000005621
UniProt: A0A2I2V0N7
Position
A2
AA seq 2161 aa AA seqDB search
MMMMMMMKNMHHQRQQQADHANEANYARGTRLPLSGEGPTSQPNSSKQTVLSWQAAIDAA
RQAKAAQTMSTSAPPPVGSLSQRKRQQYAKSKKQGNSSNSRPARALFCLSLNNPIRRACI
SIVEWKPFDIFILLAIFANCVALAIYIPFPEDDSNSTNHNLEKVEYAFLIIFTVETFLKI
IAYGLLLHPNAYVRNGWNLLDFVIVIVGLFSVILEQLTKETEGGNHSSGKSGGFDVKALR
AFRVLRPLRLVSGVPSLQVVLNSIIKAMVPLLHIALLVLFVIIIYAIIGLELFIGKMHKT
CFFADSDVIAEEDPAPCAFSGNGRQCAANGTECRSGWVGPNGGITNFDNFAFAMLTVFQC
ITMEGWTDVLYWMNDAMGFELPWVYFVSLVIFGSFFVLNLVLGVLSGEFSKEREKAKARG
DFQKLREKQQLEEDLKGYLDWITQAEDIDPENEEEGGEESKRNTSMPTSETESVNTENVS
GGGENQGGCGSLCQAISKSKLSRRWRRWNRFNRRRCRAAVKSVTFYWLVIVLVFLNTLTI
SSEHYNQPDWLTQIQDIANKVLLALFTCEMLVKMYSLGLQAYFVSLFNRFDCFVVCGGIT
ETILVELEIMSPLGISVFRCVRLLRIFKVTRHWTSLSNLVASLLNSMKSIASLLLLLFLF
IIIFSLLGMQLFGGKFNFDETQTKRSTFDNFPQALLTVFQILTGEDWNAVMYDGIMAYGG
PSSSGMIVCIYFIILFICGNYILLNVFLAIAVDNLADAESLNTAQKEEAEEKERKKIARK
ESLENKKNNKPEVNQIANSDNKVTIDDYREEDEDKDPYPPCDVPVGEEEEEEEEDEPEVP
AGPRPRRISELNMKEKIAPIPEGSAFFILSKTNPIRVGCHKLINHHIFTNLILVFIMLSS
AALAAEDPIRSHSFRNTILGYFDYAFTAIFTVEILLKMATFGAFLHKGAFCRNYFNLLDM
LVVGVSLVSFGIQSSAISVVKILRVLRVLRPLRAINRAKGLKHVVQCVFVAIRTIGNIMI
VTTLLQFMFACIGVQLFKGKFYRCTDEAKSNPEECRGLFILYKDGDVDNPVVRERIWQNS
DFNFDNVLSAMMALFTVSTFEGWPALLYKAIDSNGENVGPIYNYRVEISIFFIIYIIIVA
FFMMNIFVGFVIVTFQEQGEKEYKNCELDKNQRQCVEYALKARPLRRYIPKNPYQYKFWY
VVNSSPFEYMMFVLIMLNTLCLAMQHHEQSKIFNDAMDILNMVFTGVFTVEMVLKVIAFK
PKGYFSDAWNTFDSLIVIGSIIDVALSEADPTESDNVPVPTATPGNSEESNRISITFFRL
FRVMRLVKLLSRGEGIRTLLWTFIKSFQALPYVALLIAMLFFIYAVIGMQMFGKVAMRDN
NQINRNNNFQTFPQAVLLLFRCATGEAWQEIMLACLPGKLCDPESDYSPGEEYTCGSNFA
IVYFISFYMLCAFLIINLFVAVIMDNFDYLTRDWSILGPHHLDEFKRIWSEYDPEAKGRI
KHLDVVTLLRRIQPPLGFGKLCPHRVACKRLVAMNMPLNSDGTVMFNATLFALVRTALKI
KTEGNLEQANEELRAVIKKIWKKTSMKLLDQVVPPAGDDEVTVGKFYATFLIQDYFRKFK
KRKEQGLVGKYPAKNTTIALQAGLRTLHDIGPEIRRAISCDLQDDEPEETKREEEEDVFK
RNGALLGNHVNHVNSDRRDSLQQTNTTHRPLHVQRPSIPPASDTEKPLFPPAGNSVCHNH
HNHNSIGKQAPSSTNANLNNANMSKAAPGKRPSIGNLEHMSENGHHSSHKRDREAQRRSS
IKRTRYYETYIRSDSGDEQFPTICREDPEVHGYFSDPRCLEEQEYFSGEEGSEDAGSPAG
SRQNYSYYNRYPGSNWDFERPRGYHHPQGFLEDDDSPICYDSRRSPRRRLLPPTPTSRRR
SSFNFECLRRQSSQEEAPPPPAFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRS
WATPPATPPYRDWTPCYAPLIQVERPEALDQVNGSLPSLHRSSWYTDEPGISYRTFTPAS
LTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEME
SAASNLLNGTVHPRANGGVGPVSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITT
L
NT seq 6486 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgatgatgatgatgaaaaacatgcaccatcaacggcagcagcaagcggaccac
gcgaacgaggcaaactatgcaagaggcaccagactccctctttctggtgaaggaccaact
tctcagccgaatagctccaagcaaactgtcctgtcttggcaagctgcaatcgatgctgct
agacaggccaaggctgcccaaactatgagcacctccgcacccccacctgtaggatctctc
tcccaaagaaaacgtcagcaatacgccaagagcaaaaaacagggtaactcgtccaacagc
cgacctgcccgtgcccttttctgtttatcactcaataaccccatccgaagagcctgcatt
agtatagtggaatggaaaccatttgacatatttatattattggctatttttgccaattgt
gtggccttagctatttacatcccattccctgaagatgattctaattcaacaaatcataac
ttggaaaaagtagaatatgccttcctgattatttttacagtcgagacatttttgaagatt
atagcatatggattattgctacatcctaatgcttatgttaggaatggatggaatttactg
gattttgttatagtaatagtaggattgtttagtgtaattctggaacaattaaccaaagaa
acagaaggcggtaaccactccagtggcaagtcaggaggcttcgatgtcaaagccctccga
gcctttcgagtgttacgaccacttcgactagtgtcaggagtacccagtttacaagttgtc
ctgaactccattataaaagccatggttcccctccttcacatagcccttttggtattattt
gtaatcataatctatgctattataggattggaactttttattggaaaaatgcacaaaaca
tgtttttttgctgactcagatgtcatagctgaagaggacccagcgccgtgtgcgttctca
gggaatggacgccagtgtgccgccaatggcacagagtgtaggagtggctgggttggccca
aatgggggcatcaccaacttcgataactttgccttcgccatgctcaccgtgtttcagtgc
atcaccatggagggctggacagatgtgctctactggatgaatgatgctatgggatttgaa
ttgccctgggtgtattttgtcagtctcgtcatctttgggtcatttttcgtactaaatctt
gtacttggtgtattgagcggagaattctcaaaggaaagagagaaggctaaagcccgggga
gatttccagaagctccgggagaagcagcagctagaggaggatctaaagggctacttggat
tggatcacccaagcagaggacatcgatcctgagaacgaggaagaaggaggagaggaaagc
aaacgcaacaccagcatgccgaccagcgagacggagtctgtgaacacggagaacgtaagt
ggtggaggcgagaaccaaggcggctgtgggagtctctgccaagccatctcaaaatccaag
ctcagccgccgctggcgccgctggaaccgattcaatcgcaggagatgtagggctgctgtg
aagtctgtcacattttactggctggttattgtcctggtgtttctcaacaccttaaccatt
tcctccgagcactacaaccagcctgattggttgacgcagattcaagatatcgctaacaaa
gtcctcctggctctgttcacctgcgagatgctggtaaaaatgtacagcttgggtctccag
gcgtatttcgtctctctttttaatcggtttgactgcttcgtggtatgtggtggaattact
gaaaccatcctggtggagctggaaatcatgtctcccctggggatctctgtgtttcggtgt
gtgcgcctcttaaggattttcaaggtgaccaggcactggacttccctgagcaacttggtg
gcctccttgttaaactccatgaagtccattgcttcgctgttgcttctgctttttctcttc
atcatcatcttttccttgcttgggatgcagctgtttggtggcaagtttaattttgacgaa
acgcagaccaagcggagcacctttgacaatttccctcaagccctcctgacggtattccag
attctgacaggtgaagattggaacgctgtgatgtatgatggcatcatggcctatggcggc
ccatcgtcctcgggaatgatcgtctgcatctacttcatcatcctcttcatttgtggtaac
tatatcctactgaatgtcttcttggccatcgctgtagacaatctggctgatgctgaaagt
ttgaatactgcccagaaagaggaagctgaagagaaggaaaggaagaagattgccagaaaa
gagagcctggagaataaaaagaacaacaaaccagaggtcaaccagatagccaacagtgac
aataaggttacaattgatgactatcgagaagaggatgaagacaaggacccctacccacct
tgtgatgtgccagtaggggaagaggaagaggaggaggaagaggatgaacccgaggttcca
gctggcccccgtcctcgtagaatctcagagttgaacatgaaggagaaaatcgcccccatc
cctgaagggagtgcattcttcattctgagcaagaccaacccgatccgcgtgggctgccac
aagctcatcaaccatcacatcttcaccaacctcatcctcgtcttcatcatgctgagtagc
gccgcccttgccgccgaggaccccatccgcagccactccttccggaacactatactgggt
tactttgactatgctttcacagccatctttacagttgaaatcctgttaaagatggcgact
tttggagctttcctccacaaaggggctttctgcaggaactacttcaatctgctggatatg
ctggttgtcggggtatccctggtatcattcgggatccaatccagtgccatctccgttgtg
aagattctgagggtcttaagggtcctgaggccgctcagggcgatcaacagagcgaaagga
ctcaagcacgtggtccagtgcgtctttgtggccatccggaccatcggcaacatcatgatc
gtcaccacccttctccagttcatgttcgcctgcatcggggtccagttgttcaaggggaag
ttctatcgctgcacggacgaagccaaaagtaaccccgaagagtgcagggggcttttcatc
ctctataaggatggggacgttgataaccctgtggtccgtgagaggatctggcaaaatagt
gatttcaactttgacaacgtcctttctgctatgatggcgctgttcacggtctccacgttt
gagggctggcctgcgttgctgtataaagccatcgactccaacggagagaatgttggcccc
atctacaactaccgcgtggagatctccatcttcttcatcatctacatcatcattgtggct
ttcttcatgatgaacatctttgtgggcttcgtcatcgtcacatttcaggagcagggagag
aaagagtataagaactgtgagctggacaaaaatcagcgtcagtgtgtcgaatacgccttg
aaagcacgtcccttgcggagatacatccccaaaaacccctaccagtacaagttctggtac
gtggtgaactcctcgcctttcgaatacatgatgtttgtcctcatcatgctcaacacactc
tgcttggccatgcagcaccacgagcagtccaagatatttaatgatgccatggacattctg
aacatggtcttcactggggtgttcaccgtcgagatggttttgaaagtcattgcatttaaa
cctaaggggtattttagtgacgcctggaacacgtttgactccctcatcgtaatcggcagc
attatagacgtggccctcagcgaagccgacccaactgaaagtgacaatgtccctgtcccc
accgctacacccgggaactctgaagagagcaatagaatctccatcacctttttccgtctt
ttccgagtgatgcggttggtgaagcttctcagcaggggggaaggcatccggacactgctg
tggacttttataaagtcctttcaggcactgccctatgtcgccctcctcatagccatgcta
ttcttcatctacgcggttattggcatgcagatgtttgggaaggttgctatgagagataac
aaccagatcaacaggaacaacaatttccagacctttccccaggcagtgctgctactcttc
aggtgtgccacaggggaagcctggcaggagatcatgctggcctgcctcccggggaagctc
tgtgaccccgagtcggattacagccccggggaggagtacacgtgtggaagcaacttcgcc
attgtttatttcatcagtttttacatgctctgcgcatttctgatcatcaacctgtttgta
gctgtcatcatggacaactttgattatctgacccgggactggtctattctggggcctcac
catttggatgaattcaaaagaatatggtcagaatatgaccctgaggcaaagggaaggatc
aagcaccttgatgtggtcactctgctccgcagaatccagcctcccctggggtttgggaaa
ttatgcccacacagagtagcctgtaagagactagttgccatgaacatgcctctcaacagt
gatgggacagtcatgtttaatgcaactctgtttgctttggttcggacggctcttaaaatc
aagacggaagggaacctggaacaagctaatgaagagctccgagctgtgataaagaaaatc
tggaagaaaaccagcatgaaactgcttgaccaagttgtccctccagctggtgatgatgag
gtaaccgtggggaagttctatgccactttcctgatacaggactactttaggaaattcaag
aaacggaaagaacaaggcctggtgggaaaataccctgcgaagaacaccaccattgcccta
caggcaggattaaggacactgcatgacattgggccagaaatccggcgtgctatatcatgt
gatttgcaagatgacgagccggaggaaacaaaacgagaagaagaagaagatgtattcaaa
agaaatggtgccctgcttggaaaccatgtcaatcatgttaatagtgataggagagattcc
cttcagcagaccaataccacccaccgtcccctgcatgtccaaaggccttcaattccacct
gcaagtgatactgagaaaccgctgtttcctccagcaggaaattcggtgtgtcataaccat
cataaccataattccataggaaagcaagctcccagctcaacaaatgccaatctcaataat
gccaatatgtccaaagctgcccctggaaagcggcccagcattgggaaccttgagcatatg
tctgaaaatgggcatcactcctcccacaagcgtgaccgtgaggctcaaagaaggtccagt
attaaaagaacccgctattatgaaacttacattaggtctgactcaggagatgagcagttc
ccaactatttgccgggaagatccagaggtacacggctacttcagcgacccccgctgcttg
gaggagcaggagtatttcagtggtgaggagggctctgaggatgccggctcaccggccggg
agcaggcagaactacagctactacaacagatacccaggcagcaactgggacttcgagcgg
cctcgaggctaccatcacccccaaggcttcttggaagatgacgactcacccatttgctat
gactctcggagatctccaaggagacgcctactacctcccaccccaacatcccgccggaga
tcctccttcaacttcgagtgtctgcgccggcagagcagccaggaagaggccccgccgccc
cccgccttcccccaccgcacagccctgcccctgcacctgatgcagcagcagatcatggca
gttgcgggcctggattccagtaaagcccagaagtactcgccgagccactcaacccggtca
tgggccacccctccggcgactcctccgtaccgggactggacaccgtgctatgcacccctg
atccaggtggagcggccagaggccctggaccaggtcaacggcagcctgccgtccctgcac
cgaagctcctggtacacggacgagccgggcatctcgtaccgaactttcacaccagccagc
ctgactgtccccagcagcttccgcaacaaaaacagtgacaagcagaggagcgcagacagc
ttggtggaagcagtcctgatatccgaaggtttaggacggtatgcaagggacccaaaattt
gtatcggccacaaaacacgaaatcgccgatgcctgtgacctaaccatcgacgagatggag
agtgcagccagcaacctgctcaacgggactgtacatccccgggccaacgggggtgtgggc
cccgtgtcacaccggcaggactatgagctccaggactttgggccaggctacagcgatgaa
gagcccgaccctggaagggatgaggaggacctggcagatgaaatgatatgcatcaccacc
ctgtag

KEGG   Felis catus (domestic cat): 654399Help
Entry
654399            CDS       T02385                                 

Gene name
CACNA1S
Definition
(RefSeq) voltage-dependent L-type calcium channel subunit alpha-1S
  KO
K04857  voltage-dependent calcium channel L type alpha-1S
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04260  Cardiac muscle contraction
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04723  Retrograde endocannabinoid signaling
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04727  GABAergic synapse
fca04911  Insulin secretion
fca04912  GnRH signaling pathway
fca04921  Oxytocin signaling pathway
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05410  Hypertrophic cardiomyopathy (HCM)
fca05412  Arrhythmogenic right ventricular cardiomyopathy (ARVC)
fca05414  Dilated cardiomyopathy (DCM)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    654399 (CACNA1S)
   04020 Calcium signaling pathway
    654399 (CACNA1S)
   04024 cAMP signaling pathway
    654399 (CACNA1S)
   04022 cGMP-PKG signaling pathway
    654399 (CACNA1S)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    654399 (CACNA1S)
   04912 GnRH signaling pathway
    654399 (CACNA1S)
   04921 Oxytocin signaling pathway
    654399 (CACNA1S)
   04924 Renin secretion
    654399 (CACNA1S)
   04925 Aldosterone synthesis and secretion
    654399 (CACNA1S)
   04927 Cortisol synthesis and secretion
    654399 (CACNA1S)
  09153 Circulatory system
   04260 Cardiac muscle contraction
    654399 (CACNA1S)
   04261 Adrenergic signaling in cardiomyocytes
    654399 (CACNA1S)
   04270 Vascular smooth muscle contraction
    654399 (CACNA1S)
  09156 Nervous system
   04727 GABAergic synapse
    654399 (CACNA1S)
   04725 Cholinergic synapse
    654399 (CACNA1S)
   04726 Serotonergic synapse
    654399 (CACNA1S)
   04723 Retrograde endocannabinoid signaling
    654399 (CACNA1S)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    654399 (CACNA1S)
  09166 Cardiovascular disease
   05410 Hypertrophic cardiomyopathy (HCM)
    654399 (CACNA1S)
   05412 Arrhythmogenic right ventricular cardiomyopathy (ARVC)
    654399 (CACNA1S)
   05414 Dilated cardiomyopathy (DCM)
    654399 (CACNA1S)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    654399 (CACNA1S)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    654399 (CACNA1S)
Ion channels [BR:fca04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   654399 (CACNA1S)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ion_trans Ca_chan_IQ GPHH PKD_channel CAC1F_C
Motif
Other DBs
NCBI-GeneID: 654399
NCBI-ProteinID: NP_001033694
Ensembl: ENSFCAG00000004605
UniProt: Q2QCM6
Position
F1
AA seq 1871 aa AA seqDB search
MEPSSPQDEGLRKKQPKKPVPEILPRPPRALFCLTLQNPLRKACINIVEWKPFETIILLT
IFANCVALAVYLPMPEDDNNTLNLGLEKLEYFFLIVFSIEAAMKIIAYGFLFHQDAYLRS
GWNVLDFIIVFLGVFTVILEQVNVIQSNTAPMSSKGAGLDVKALRAFRVLRPLRLVSGVP
SLQVVLNSIFKAMLPLFHIALLVLFMVTIYAIIGLELFKGKMHKTCYFIGTDIVATVENE
KPSPCARTGSGRPCTINGSECRGGWPGPNHGITHFDNFGFSMLTVYQCITMEGWTDVLYW
VNDAIGNEWPWIYFVTLILLGSFFILNLVLGVLSGEFTKEREKAKSRGTFQKLREKQQLE
EDLRGYMSWITQGEVMDVEDLREGKLSLDEGGSDTESLYEIEGLNKIIQFVRHWRQWNRI
FRWKCHDVIKSRVFYWLVILVVALNTLSIASEHHNQPLWLTHLQDVANRVLLALFAVEML
LKMCGLGLRQYFMSIFNRFDCFVVCSGVLELLLVESGAMTPLGISVLRCIRLLRIFKITK
YWTSLSNLVASLLNSIRSIASLLLLLFLFIIIFALLGMQLFGGRYDFEDTEVRRSNFDNF
PQALISVFQVLTGEDWNSVMYNGIMAYGGPSYPGVLVCIYFIILFVCGNYILLNVFLAIA
VDNLAEAESLTSAQKAKAEERKRRKMSKGLPDKSEEEKSVMAKKLEQKPKGEGIPTTAKL
KIDEFESNVNEVKDPYPSADFPGDDEEDEPEIPVSPRPRPLAELQLKEKAVPIPEASSFF
IFSPTNKIRVLCHRIVNATWFTNFILLFILLSSAALAAEDPIRAESVRNQILGYFDIAFT
SVFTVEIVLKMTTYGAFLHKGSFCRNYFNILDLLVVAVSLISMGLESSAISVVKILRMLR
VLRPLRAINRAKGLKHVVQCVFVAIRTIGNIVLVTTLLQFMFACIGVQLFKGKFFSCNDL
SKMTEKECRGYYYVYKDGDPTQMELRPRQWIHSDFHFDNVLSAMMSLFTVSTFEGWPQLL
YQAIDSYKEDTGPVYNNRVEMAIFFIIYIILIAFFMMNIFVGFVIVTFQEQGETEYKNCE
LDKNQRQCVQYALKARPLRCYIPKNPYQYQVWYVVTSSYFEYLMFALIMLNTICLGMQHY
NQSEEMNHISDILNVAFTIIFTLEMVLKLMAFKARGYFGDPWNVFDFLIVIGSIIDVILS
EIDTFLASSGGLYCLGGGCGNVDPDESARISSAFFRLFRVMRLIKLLSRAEGVRTLLWTF
IKSFQALPYVALLIVMLFFIYAVIGMQMFGKIAMVDGTQINRNNNFQTFPQAVLLLFKCS
TSEALQEILLACSYGKLCDPESDYAPGEEYTCGTNFAYYYFVSFYMLCAFLIINLFVAVI
MDNFDYLTRDWSILGPHHLDEFKAIWAEYDPEAKGRIKHLDVVTLLRRIQPPLGFGKFCP
HRVACKRLVGMNMPLNSDGTVTFNATLFALVRTALKIKTEGNFEQANEELRAIIKKIWKR
TSMKLLDQVIPPIGDDEVTVGKFYATFLIQEHFRKFMKRQEEYYGYRPKKDTVQIQAGLR
TIEEEAAPEIRRTISGDLTAEEELERAMVEAAMEEGIFRRTGGLFGQVDNFMERTNSLPP
VMANQRPLQFAEIEMEELESPVFLEDFPQDPRTNPLAHANTNNANANVACDNSSHSNSQL
FSSIRYEREFPGETETPAARGGAFGQPRSVLGAHSKSCVEKLKGQLAQREMPGAQASPTP
CQRADAEPPLPGERRDPTPGPEEASHHGRTKESSSRCQTPATARLIQEALVRGGLDTLAA
DADFVTVTGRALADACQMEPEDVEVAATELLKRQESPEGMASAQGRLSLGSSLGSLDQHQ
GSQETLIPRRL
NT seq 5616 nt NT seq  +upstreamnt  +downstreamnt
atggagccatcctcaccccaggatgagggcctgaggaagaaacagcccaagaagcccgtt
cctgagattctgccaaggccaccccgggccttgttctgcttgaccctccagaaccccctg
aggaaggcctgcatcaacatcgtggaatggaaacccttcgagacaatcatcttgctcacc
atctttgccaactgtgtggccctggctgtgtacctgcccatgccagaagatgacaacaac
actctcaaccttggtctggagaaactggagtatttcttcctcatcgtcttctcaatcgaa
gccgccatgaagatcattgcctatggcttcctgttccaccaggatgcctacctgcgcagc
ggctggaatgtgctagacttcatcatcgtcttcctgggggttttcaccgtgattctggaa
caggttaacgtcatccaaagcaacaccgccccgatgagcagcaaaggggctggcctggac
gtcaaggccctgagagccttccgtgtgctcagacccctccggcttgtgtcgggggtgccg
agcctgcaggtggtcctcaactccatcttcaaggccatgcttcccctgttccacatcgcc
ctgctcgtcctctttatggtcaccatctatgccatcatcgggctggagctcttcaagggc
aaaatgcacaagacctgctacttcattgggacagatatcgtggccacggtagagaacgag
aagccctcaccctgcgccaggacgggctcgggacgcccgtgcaccatcaacggcagcgag
tgtcggggcggctggccggggcccaaccacggcatcacgcactttgacaactttggcttc
tccatgctcaccgtgtaccagtgcatcaccatggaggggtggaccgatgtcctctactgg
gtcaatgatgccatcgggaacgagtggccctggatctattttgtcaccctcattctgctg
gggtccttcttcattctcaacctggtgctgggtgtcctgagcggggaattcactaaggag
cgggagaaggccaagtccaggggaaccttccaaaagctccgggagaagcagcagctggaa
gaggacctccggggctacatgagctggatcacgcagggcgaggtcatggacgttgaggac
ttgagagaagggaagctgtctctggatgaaggaggctccgacacagagagcctgtatgaa
atcgagggcttgaacaaaatcatccagtttgtccgccactggaggcagtggaaccgcatc
tttcgctggaagtgccacgatgtgatcaagtccagagtcttctattggctggtgatcctg
gtcgttgccctcaacaccctgtctatcgcctcagagcaccacaaccagcctctctggttg
acccatttgcaagacgttgccaaccgagtgctgctggccctcttcgccgtcgagatgctg
ctgaagatgtgcgggctgggcctgcgccagtacttcatgtccatcttcaaccgcttcgac
tgcttcgtggtgtgcagcggcgtcctggagctgctgctggtggagtcaggtgccatgacg
cccctgggcatctccgtgctgcgctgcatccgcctcctgcggatcttcaagatcaccaag
tactggacgtcgctgagcaacctggtggcatccctgctcaactccatccgctccatcgcc
tccctgctgctgctgcttttcctcttcatcatcatcttcgccctgctgggcatgcagctc
ttcgggggcaggtacgacttcgaggacacggaggtgcggcgcagcaactttgacaacttc
ccgcaggccctcatcagcgtcttccaggtcctaacaggtgaagactggaattctgtgatg
tacaacgggatcatggcctacggcgggccgtcctaccctggggtgctcgtgtgcatttat
ttcatcatcctttttgtctgtggcaactatatcctgctcaatgtcttcctggccatcgct
gtggacaacctggctgaggcagagagcctgacttctgcccagaaggccaaagctgaggag
agaaaacgcaggaagatgtccaagggtcttccagataagtcagaggaagagaagtcagta
atggccaagaagctggaacagaaacccaagggtgaaggcatccctaccaccgccaagctg
aaaatcgatgaatttgaatctaatgtcaatgaagtgaaggatccctacccctcagctgac
ttcccaggagatgatgaggaagatgagcccgagatcccagtgagcccccgaccacgcccg
ctggctgagctgcagctcaaagagaaggcagtgcccatcccagaagccagctccttcttc
attttcagccccaccaacaagatccgtgtcttgtgtcatcgcattgtcaacgctacctgg
ttcaccaacttcatccttcttttcatcctgctcagcagtgccgcactggccgcagaggac
cccatccgggccgagtccgtgaggaatcagatccttgggtatttcgacattgcgttcacc
tctgtcttcactgtggagattgtcctcaagatgacgacctacggtgccttcctgcacaag
ggctccttctgccgcaactatttcaacatcctggacctgctggtggtggccgtgtccctc
atctccatgggactcgagtccagcgccatctctgtggtgaaaatcctgaggatgctgagg
gtgctccggcccctgcgggccatcaacagagcaaaggggctgaagcacgtggtgcagtgt
gtgtttgtggccatccgcaccatcgggaacatcgtcctcgtcaccaccctcctgcagttc
atgtttgcctgcatcggcgtccagcttttcaagggcaagttcttcagctgcaatgactta
tccaagatgacagagaaggagtgcaggggctattactatgtgtacaaggatggggacccc
acccagatggagctgcgcccccgccagtggatacacagcgacttccatttcgacaacgtg
ctctcggccatgatgtcactcttcacggtctccacctttgagggatggcctcagctgctt
taccaggccatagactcatacaaggaagacacaggccccgtctacaacaaccgagtggag
atggccatcttcttcatcatctacatcatcctcattgccttcttcatgatgaacatcttt
gtgggcttcgttattgtcaccttccaggagcagggggagactgagtacaagaactgtgaa
ctggacaagaaccagcgccagtgtgtgcaatatgccctgaaggcccgcccgctgaggtgc
tacatccccaaaaacccataccagtaccaggtgtggtatgtcgtcacctcctcctacttt
gagtacctgatgtttgccctcatcatgctcaacaccatctgcctgggcatgcagcactac
aaccagtcagaggagatgaaccacatctcagacatcctcaacgtggccttcaccatcatc
ttcaccctggagatggtcctcaagctcatggcgttcaaggccaggggctattttggagac
ccctggaatgtgtttgacttcttgattgtcatcggcagcatcatcgatgtcattctcagt
gaaatcgacactttcctggcctccagcgggggactgtattgcctgggtggaggctgcggg
aacgttgacccagacgagagcgcccggatctccagcgccttctttcgcctgttccgggtc
atgaggctgatcaagctgctgagccgggcagagggagtgcgcactctgctgtggacgttc
atcaagtccttccaggccctgccatacgtggccctgctcatcgtcatgctcttcttcatc
tacgccgtcatcggcatgcagatgtttggtaagatcgccatggtggacgggacccaaata
aaccggaacaacaacttccagaccttcccacaagctgtgttgctgctcttcaagtgttcc
acaagtgaagccttgcaggagatcctcctggcctgcagctacggcaagttgtgtgacccc
gaatcggattatgccccgggtgaggagtacacgtgtggcaccaacttcgcctactattac
ttcgtcagcttctacatgctctgcgccttcctgatcatcaacctgtttgtagctgtcatc
atggacaactttgactacctcacccgggactggtccatcctgggcccccatcacctggat
gagttcaaagccatttgggcagagtatgacccggaggctaagggcagaatcaaacacctg
gatgtggtgaccctgctgagacggatccaaccccctctgggctttgggaagttctgccca
caccgggtagcatgtaagcggctggtgggcatgaacatgcccttgaacagcgacggcacg
gtcaccttcaacgccactctcttcgccctggtccgcacagcactcaagatcaagacggaa
ggtaactttgagcaggccaatgaggagctgagggccatcatcaagaagatctggaagaga
accagcatgaagctcttggatcaggtcattcctccaataggagatgatgaggtgactgta
gggaagttctacgccacgtttctcatccaggagcacttccggaagttcatgaagcgccag
gaagagtattatgggtatcggcccaagaaggacactgtacagatccaggccggactgcgg
accattgaggaagaggcagccccagagatccggcgcaccatctcaggagacctgacagct
gaagaagagctggagagagccatggtggaggctgcgatggaggaagggatattccggagg
actgggggcctgtttggccaggtggacaacttcatggaaaggaccaactccctgccccct
gtgatggccaaccagagacccctccagtttgctgagatagagatggaagagctggaatca
cctgtcttcttggaggatttccctcaagatccacgcaccaaccctcttgctcatgccaac
accaataatgccaatgccaatgttgcctgtgacaacagcagccacagcaacagccagcta
ttttccagcatccgctatgaaagggagttccctggagagacagagacgcctgctgccaga
ggaggagcctttggccagccccgaagcgtcctgggagcccacagcaaatcctgtgtggaa
aagctaaaaggacagctggcccagagagaaatgcccggggcccaggcgtctcctaccccc
tgccagcgtgccgacgcagagcctcccctgcctggggagaggagggaccccaccccgggg
cctgaggaagcatcccaccacggtaggaccaaggagagtagttccaggtgccagactcca
gcgacagccaggctgatacaagaggctctggttcgaggaggcctggacaccttggcggct
gatgctgactttgtcacggtgacaggccgggccctggcagatgcctgccagatggaacca
gaggacgtggaggtggcagcaacagagctactgaaaagacaagagtccccagagggcatg
gccagtgcccagggacgcttgagcctcgggtcctcgctggggagccttgaccagcatcag
ggctcccaggagaccctgatcccccgcaggctgtga

DBGET integrated database retrieval system