KEGG   Felis catus (domestic cat): 101081083Help
Entry
101081083         CDS       T02385                                 

Gene name
ZFYVE27
Definition
(RefSeq) protrudin isoform X3
  KO
K19368  protrudin
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101081083 (ZFYVE27)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FYVE FYVE_2
Motif
Other DBs
NCBI-GeneID: 101081083
NCBI-ProteinID: XP_003994329
Ensembl: ENSFCAG00000013433
UniProt: M3WRA9
Position
D2
AA seq 404 aa AA seqDB search
MQTSEREGSGPEVSPSVMPEAPLESPPAPTKSPAFDLFNLVLSYKRLEIYLEPLKDAGDG
VRYLLRWQTPLCSLLTCLGLNILFLTLNEGAWYSVGALMISVPALLGYLQEVCRARLPES
ELMRRKYHSVRQEDLQRVRLSRPEAVAEVKSFLIQLEAFLSRLCRTCEAAYRVLHWENPA
ASSQFYGALLGTVCMLYLLPLCWVLALLNSTLFLGNVEFFRVVSEYRACLQRRMNPKQED
SVFESPPLPDAGGKCALPDCTPVPTPTEDLTPGSVEEAEEAEPDEEFKDAIEEDDEGAPC
PAEDELVLQDNGFLSKNEVLRSKVSRLTERLRKRYPTNNFGNCTGCSATFSVLKKRRSCS
NCGNSFCSRCCSFKVPKSSMGATAPEAQRETVFVCASCNQTLSK
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgcagacatcagagcgtgaggggagtgggccagaggtaagccccagcgtgatgcctgag
gctcccctggagtctccacctgcccctaccaagtccccggcgtttgatcttttcaacttg
gttctgtcctacaagaggctggagatctacctggaacccctaaaggatgcaggtgacggt
gtccgatacttgctcaggtggcagacacctttgtgttccttgctgacctgcctgggcctc
aacatcttgttcctcactttgaatgaaggtgcgtggtactcggtgggtgccctgatgatt
tcagtgcccgcccttctgggctaccttcaggaggtctgccgggcacggctgcctgagtct
gagttgatgcggaggaagtatcacagcgtgaggcaggaggacctccagagagttcgcctg
tctcgccccgaggctgtggctgaggtgaagagcttcctgatccagctggaggccttcctg
agccgcctgtgccgtacctgtgaagctgcctaccgcgtgctgcactgggagaaccctgcc
gcgtcctcgcagttctatggggctcttctgggcacagtttgcatgctgtacctgctgccc
ctgtgctgggtccttgcccttttaaacagcacgctctttctggggaatgtggagttcttc
cgagtggtatctgagtacagggcatgtctgcagcggcggatgaaccccaagcaggaagac
agtgtctttgagagccccccgctgccagatgctgggggaaagtgtgccctgccggactgc
acgcctgtgcccacacccacggaggacctcacacccggaagtgtggaggaggccgaggag
gctgagcctgatgaggagtttaaagatgcgattgaggaggatgacgagggtgccccgtgc
ccagcagaggatgagctggttctgcaggacaacgggttcctgagcaagaacgaggtgctg
cgcagcaaggtgtcccggctcacagagcggctccgcaaacgctaccctaccaacaacttt
gggaactgtacgggctgctcggccaccttctcagtgctgaagaagaggcgaagctgcagt
aactgtggaaacagcttctgctcccggtgctgctccttcaaggtgcctaagtcctccatg
ggggccacagcccccgaagcccagagagagactgtgtttgtgtgtgcctcgtgtaaccag
accttgagcaagtga

DBGET integrated database retrieval system