KEGG   Felis catus (domestic cat): 101081257Help
Entry
101081257         CDS       T02385                                 

Gene name
CLTCL1
Definition
(RefSeq) clathrin heavy chain 2 isoform X2
  KO
K04646  clathrin heavy chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04142  Lysosome
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
fca05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101081257 (CLTCL1)
   04142 Lysosome
    101081257 (CLTCL1)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101081257 (CLTCL1)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101081257 (CLTCL1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101081257 (CLTCL1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101081257 (CLTCL1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101081257 (CLTCL1)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101081257 (CLTCL1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    101081257 (CLTCL1)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101081257 (CLTCL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_7
Motif
Other DBs
NCBI-GeneID: 101081257
NCBI-ProteinID: XP_011286191
Ensembl: ENSFCAG00000002747
UniProt: A0A2I2UJZ5
Position
D3
AA seq 1673 aa AA seqDB search
MAQILPIRFQEHFQLQNLGINPANIGFSTLTMESDKFICVREKVGEQAQVVIVDMSDPMA
PIRRPISAESAIMNPASKVIALKAGKTLQIFNIEMKSKMKSHTMAEEVIFWKWVSVNTVA
LVTETTVYHWSMEGDSQPVKMFDRHASLAGCQMIHYRTDEYQKWLLLVGISAQQNRVVGA
MQLYSVDRKVSQPIEGHAAAFAEFKSEGNAKPATLFCFAVRSPTGGKLHIIEVGQPAAGN
QPFVKKAVDVFFPPEAQTDFPVAMQIGGKHGVIYLITKYGYLHMYDLESGVCIYMNRISA
DTIFVTAPHESTSGIIGVNKKGQVLSVCVEEDNIVNYATSVLQNPDLGLRLAIRSNLAGA
EELFVRKFTTLFAQGSYAEAAKVAASAPKGVLRTSDTVRKFQSIPAQPGQASPLLQYFGI
LLDQGQLNKLESLELCRLVLQQGRKQLLEKWLKEDKLECSEELGDLVKTADPTLALSVYL
RANVPSKVIQCFAETGQFQKIVLYAKKVGYTPDWIFLLRSVMRISPDQGLQFSQMLVRDE
EPLANIDQIVDVFMENSLIQQCTSFLLDALKNNRPAEGHLQTRLLEMNLIHAPQVADAIL
GNQMFTHYDRAHIAQLCEKAGLLQRALEHYTDLYDIKRAVVHTHLLNPEWLVSFFGSLSV
EDSLACLHALLSASIRQNLQLCVQVASKYHEQLGTQSLVELFESFKSYEGLFYFLGSIVN
FSQDPDVHLKYIQAACKTGQIKEVERICRESNCYNPERVKNFLKEAKLTDQLPLIIVCDR
FDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRIPAVVGGLLDVDCSEEVIKNLIMVVRGQF
STDELVAEVEKRNRLKLLLPWLESRSHEGCEEPATHNALAKIYIDSNNSPERFLRENAYY
DSRVVGRYCEKRDPHLACVAYERGQCDLELIKVCNENSLFKSEARYLVRRKDPELWAHVL
EETNPSRRQLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFSE
HRNLQNLLILTAIKADRTRVMEYISRLDNYDAPDIANIAVSSALYEEAFTIFRKFDVNAS
AIQVLIEHIGNLDRAYEFAERCNEPAVWSQLACAQLQKDLVKEAIDSYIRADDPSSYLEV
VQAASRNNNWEDLVKFLQMARRKGRESYIETELIFALAKTGRLSELEDCINGPNNAHIQQ
VGDRCYEEGMYEAAKLLYSSVSNFARLASTLVHLGEYQAAVDSSRKANSTRTWKEVCFAC
VDGQEFRLAQLCGLHIVIHADELEELIRYYQDRGYFEELISLLEAALGLERAHMGMFTEL
AILYSKFKPQKMPEHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAVLTMIN
HPTDAWREGQFKDVIAKVANVELYYKALQFYLDYKPLLINDLLLVLAPRLDHTRTVGFFS
KAGQLPLVKPYLRSVQSHNNKSVNEALNHLLTEEEDYQGLRASIDAYDNFDNIALAQRLE
KHQLIEFRRIAAYLYKGNNRWAQSVELCKKDHLYKDAMQHAAESRDAELAEKLLQWFLEE
GKRECFAASLFTCYDLLPPDVVLELAWRHNLVDLAMPYFIQVMREYLSKVDRLDASESLR
KQEEHVVEPAPLLFGQQLMLTAGPAAGPAPAGFPYGYAAAPAFAQPPVYGFSV
NT seq 5022 nt NT seq  +upstreamnt  +downstreamnt
atggcgcagatcctccccatccgcttccaggagcacttccagctccaaaacctgggaatt
aatccagccaacattggattcagcacactgaccatggaatctgataagtttatatgtgtc
cgagaaaaggttggtgagcaggcacaggtagtgattgttgacatgagtgatccaatggca
ccaatcagacggcccatctctgcagaaagtgccatcatgaatccagcctctaaggtgata
gctttgaaagctggaaagacacttcaaatctttaatattgaaatgaagagtaaaatgaag
tctcataccatggcagaagaggtgattttctggaaatgggtctctgtgaatactgttgcc
cttgtgactgagacaacagtctaccactggagcatggaaggtgactctcagcctgtgaag
atgtttgatagacatgccagtctggcagggtgccagatgatccactaccggactgatgag
tatcagaagtggctgctcctcgttggcatctcagctcagcaaaaccgtgtagttggggca
atgcaactctactctgtggataggaaagtttcacaacccatagaaggccatgctgctgct
tttgcagagttcaagagcgaagggaatgccaagcctgccacccttttctgctttgctgta
cgtagtcccacagggggcaagttgcacataatcgaagtcggacagcctgcagcaggaaac
cagccttttgtaaagaaagctgtggatgtgtttttccctccagaggctcagactgatttc
ccagtggctatgcagattggaggtaaacatggtgttatttacttgatcacgaaatatggc
tatcttcacatgtatgacctagagtctggcgtgtgcatctacatgaaccgtatcagtgct
gacacgatatttgtcactgctccacatgaatctacttctggaattattggtgtcaacaaa
aagggacaggtgctgtcagtttgtgtcgaggaagataacattgtgaattatgcaaccagt
gtgcttcaaaatccagaccttggtctgcgcttggccattcgtagtaacttggctggggcg
gaggagttattcgtgagaaaattcactaccctctttgcacaggggagctatgctgaagcc
gccaaagtagcagcatctgcaccaaagggagtcctgcgtaccagtgacacagttcggaag
ttccaaagtattcccgcccagcctgggcaggcctctcctttgctccagtactttggaatc
ctccttgaccagggtcagctcaataaacttgaatccttagaactttgccgtctagtgctt
cagcagggtcgcaagcaactcttagaaaagtggctgaaagaagataagctggagtgttca
gaagaacttggagatttggtcaaaactgctgaccctacacttgctctgagtgtgtatctt
cgggcaaatgtgccgagcaaggttatccagtgttttgcagaaacaggccaattccagaaa
attgtcctctatgccaaaaaggttggctataccccagactggatctttttactgaggagt
gtgatgagaatcagtccagaccagggcctgcagttttctcaaatgctagtgcgagatgag
gagccattggccaatattgaccagattgtagacgttttcatggaaaacagtttaattcag
cagtgtacctccttcttgttggatgccttgaaaaataaccgcccagctgaggggcacctc
cagacgcgcctgttggagatgaacctgattcacgcaccccaggttgcagatgccattctt
ggaaatcagatgtttacccattatgatcgggcccacatcgcccagctctgtgaaaaggca
ggcctcctgcagcgtgcgctggagcactacactgacctgtatgacatcaagagggctgtg
gtccacactcacctcctcaatcccgagtggctcgtcagcttctttggctccttgtcagtg
gaggattctttggcgtgtcttcatgctttgctgtctgccagcatcagacagaaccttcag
ctgtgtgtgcaggtagcctccaagtaccatgagcagctgggcacacagtccctggtggag
ctctttgaatccttcaagagttacgaaggcctcttctacttcctgggctcaattgtgaac
ttcagccaagatccagatgtgcacttgaaatacattcaggctgcctgtaagacgggacag
atcaaggaggtggagaggatatgccgggagagtaattgctacaacccagagcgggtgaag
aattttctgaaggaggccaagctcacagaccagcttcctctcatcatcgtgtgtgatcgg
tttgactttgtacatgacctcgtcctgtacttataccgcaacaacctgcagaagtacatc
gaaatctacgttcagaaggtcaaccctagccggatccctgctgtggttggagggctgctt
gatgtggattgttctgaggaagtaattaaaaacttaatcatggtggtgagaggacagttc
tccactgatgagctggtggctgaagtagaaaaaagaaacaggctaaagctgcttcttccc
tggctggagtcccggagtcacgaaggctgtgaagagcctgccactcacaatgctcttgcc
aagatctacatcgacagcaacaacagccccgagcgcttcctgagagaaaatgcttactat
gacagccgcgtggtgggccgctactgtgagaagcgggacccacatctggcctgcgttgcc
tatgagcgggggcagtgtgaccttgagctcatcaaggtttgcaatgagaattctctgttc
aaaagtgaggcccgttacttggtgcgcaggaaagatccagagctctgggctcatgtcctt
gaggagaccaacccttccaggcgacagctgattgaccaggtggtacagacagcattgtca
gaaacacaggatcctgaagaggtctcagtcactgtcaaggccttcatgacagctgatctg
cctaatgaactgattgagctgctggagaagattgttctggataactcagtctttagtgag
cacaggaatctccagaatttgctgatcctgactgccatcaaggcagaccgcacgcgggtc
atggaatacatcagccgcctggacaactacgatgccccagacattgcgaacatcgccgtt
agtagtgcactgtatgaggaggccttcaccatctttcgcaagtttgatgtgaatgcatca
gcaatccaggtcctgattgagcacattggaaacctagaccgagcatacgagtttgcagag
agatgcaatgaacctgctgtgtggagtcagctggcctgcgcccagctccagaaagacttg
gtgaaggaagccatcgactcctacatcagagctgacgacccttcctcttacttggaagtc
gttcaggcagccagtaggaacaacaattgggaagatctggtgaaattcctacagatggcc
aggagaaagggccgtgaatcctatatagagactgaacttatttttgccctggctaaaact
ggtcgcctgtctgagttagaagattgtattaatggacccaacaatgcccacatccaacag
gttggagaccgctgttacgaggagggaatgtatgaggctgctaagctgctctacagcagt
gtttctaactttgcccgcctggcttccaccctggtccaccttggagagtatcaggcagcc
gtggacagcagccgcaaagccaacagcacccggacgtggaaggaggtatgctttgcatgc
gtggatgggcaggagttccgccttgcacaactgtgtggtcttcacattgtcattcacgca
gatgagctggaggagctgatacgctattaccaggatcggggctactttgaggaactgatc
tccctgctggaggcagccctgggcctggagcgggcccacatgggcatgttcacagaactg
gccatcctctactccaaattcaagcctcagaagatgccagagcacctggagctcttctgg
tcccgagtcaacatcccaaaggtgctgagagctgcagagcaggcgcacctctgggcagag
ctggtgttcctctatgacaagtacgaagagtacgataatgccgtccttaccatgatcaat
caccctactgatgcctggagggaagggcaattcaaggatgtcattgccaaggttgctaat
gtggagctctactataaagccctgcagttctatttggattacaaacctctgctcataaat
gacctgttgcttgtgcttgcaccccggctggaccatacccggactgttggcttcttttca
aaggcaggccagttgcccctagtgaagccttacctgcggtcagtccagagccacaacaac
aagagtgtgaatgaggccctcaaccacctactgacagaagaggaggattaccagggtttg
agggcatctatcgatgcctacgacaactttgacaacattgccctggcacagaggttggag
aagcaccagctgattgagttcaggcgcattgcagcttatctatacaagggcaacaaccgg
tgggcccagagcgtggagctctgcaagaaggaccatctctacaaggatgccatgcagcat
gctgcagagtctagagatgccgagctggccgagaagttgctgcagtggttcctggaagag
ggcaagcgggagtgcttcgcggcctctctcttcacctgctacgacctgcttcctccagat
gtggtgctggagctggcctggagacacaacctcgttgacctggccatgccctacttcatc
caggtgatgagagagtaccttagcaaagtagacagactggatgcctcggagagcctacgc
aagcaagaggaacatgtggtggagcctgcccctctcttgtttggccagcagctgatgctg
acagcaggccctgctgcaggccctgcccctgctggcttcccctatggatatgctgctgca
cctgccttcgcccagcctcctgtgtacggcttcagcgtgtag

KEGG   Felis catus (domestic cat): 101081341Help
Entry
101081341         CDS       T02385                                 

Gene name
CLTC
Definition
(RefSeq) LOW QUALITY PROTEIN: clathrin heavy chain 1
  KO
K04646  clathrin heavy chain
Organism
fca  Felis catus (domestic cat)
Pathway
fca04142  Lysosome
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
fca05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101081341 (CLTC)
   04142 Lysosome
    101081341 (CLTC)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101081341 (CLTC)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101081341 (CLTC)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101081341 (CLTC)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101081341 (CLTC)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101081341 (CLTC)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101081341 (CLTC)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    101081341 (CLTC)
Exosome [BR:fca04147]
 Exosomal proteins
  Proteins found in most exosomes
   101081341 (CLTC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin Clathrin_propel Clathrin_H_link Clathrin-link Coatomer_WDAD TPR_1
Motif
Other DBs
NCBI-GeneID: 101081341
NCBI-ProteinID: XP_019673151
Ensembl: ENSFCAG00000027260
Position
E1
AA seq 1676 aa AA seqDB search
MAQILPIRFQEHLQLQNLGINPANIGFSTLTMESDKFICIREKVGEQAQVVIIDMNDPSN
PIRRPISADSAIMNPASKVIALKDAGKTLQIFNIEMKSKMKAHTMTDDVTFWKWISLNTV
ALVTDNAVYHWSMEGESQPVKMFDRHSSLAGCQIINYRTDAKQKWLLLTGISAQQNRVVG
AMQLYSVDRKVSQPIEGHAASFAQFKMEGNAEESTLFCFAVRGQAGGKLHIIEVGTPPTG
NQPFPKKAVDVFFPPEAQNDFPVAMQISEKHDVVFLITKYGYIHLYDLETGTCIYMNRIS
GETIFVTAPHEATAGIIGVNRKGQVLSVCVEEENIIPYITNVLQNPDLALRMAVRNNLAG
AEELFARKFNALFAQGNYSEAAKVAANAPKGILRTPDTIRRFQSVPAQPGQTSPLLQYFG
ILLDQGQLNKYESLELCRPVLQQGRKQLLEKWLKEDKLECSEELGDLVKSVDPTLALSVY
LRANVPNKVIQCFAETGQVQKIVLYAKKVGYTPDWIFLLRNVMRISPDQGQQFAQMLVQD
EEPLADITQIVDVFMEYNLIQQCTAFLLDALKNNRPSEGPLQTRLLEMNLMHAPQVADAI
LGNQMFTHYDRAHIAQLCEKAGLLQRALEHFTDLYDIKRAVVHTHLLNPEWLVNYFGSLS
VEDSLECLRAMLSANIRQNLQICVQVASKYHEQLSTQSLIELFESFKSFEGLFYFLGSIV
NFSQDPDVHFKYIQAACKTGQIKEVERICRESNCYDPERVKNFLKEAKLTDQLPLIIVCD
RFDFVHDLVLYLYRNNLQKYIEIYVQKVNPSRLPVVIGGLLDVDCSEDVIKNLILVVRGQ
FSTDELVAEVEKRNRLKLLLPWLEARIHEGCEEPATHNALAKIYIDSNNNPERFLRENPY
YDSRVVGKYCEKRDPHLACVAYERGQCDLELINVCNENSLFKSLSRYLVRRKDPELWGSV
LLESNPYRRPLIDQVVQTALSETQDPEEVSVTVKAFMTADLPNELIELLEKIVLDNSVFS
EHRNLQNLLILTAIKADRTRVMEYINRLDNYDAPDIANIAICNELFEEAFAIFRKFDVNT
SAVQVLIEHIGNLDRAYEFAERCNEPAVWSQLAKAQLQKGMVKEAIDSYIKADDPSSYME
VVQAANTSGNWEELVKYLQMARKKARESYVETELIFALAKTNRLAELEEFINGPNNAHIQ
QVGDRCYDEKMYDAAKLLYNNVSNFGRLASTLVHLGEYQAAVDGARKANSTRTWKEVCFA
CVDGKEFRLAQMCGLHIVVHADELEELINYYQDRGYFEELITMLEAALGLERAHMGMFTE
LAILYSKFKPQKMREHLELFWSRVNIPKVLRAAEQAHLWAELVFLYDKYEEYDNAIITMM
NHPTDAWKEGQFKDIITKVANVELYYRAIQFYLEFKPLLLNDLLMVLSPRLDHTRAVNYF
SKVKQLPLVKPYLRSVQNHNNKSVNESLNNLFITEEDYQALRTSIDAYDNFDNISLAQRL
EKHELIEFRRIAAYLFKGNNRWKQSVELCKKDSLYKDAMQYASESKDTELAEELLQWFLQ
EEKRECFGACLFTCYDLLRPDVVLETAWRHNIMDFAMPYFIQVMKEYLTKVDKLDASESL
RKEEEQATETQPIVYGQPQLMLTAGPSVAVPPQAPFGYGYTAPPYGQPQPGFGYSM
NT seq 5031 nt NT seq  +upstreamnt  +downstreamnt
atggcccagattctgccaattcgttttcaggagcatctccagctccagaatctgggtata
aacccagcaaatattggcttcagtaccctaactatggagtcagacaaattcatctgcatt
agagagaaagtaggagagcaggcccaggtggtaatcattgatatgaatgacccaagtaat
ccaattcgaagaccaatttcagcagacagcgccatcatgaatccagcaagcaaagtaatt
gcactgaaagatgctgggaaaactcttcagatatttaacattgaaatgaaaagtaaaatg
aaggcccataccatgactgatgatgtcactttctggaaatggatctctttgaatacggtt
gctcttgttacggataatgcagtttatcattggagtatggaaggagagtctcagccagtg
aaaatgtttgatcgccattctagccttgcagggtgccagattatcaattatcgtacagat
gcaaagcaaaagtggttacttctgactggcatatctgcacagcaaaatcgtgtggtggga
gctatgcagttatattctgtagataggaaagtatctcagcccattgaaggacacgcggct
agttttgcgcaatttaagatggaaggaaatgcagaagaatcaacgttattttgttttgca
gtacggggtcaagctggagggaagttacatatcattgaagttggcacaccacctacaggg
aatcagccctttccaaagaaggcagtggatgttttctttcctccagaagcacaaaatgac
tttcctgttgcaatgcagatcagtgaaaagcatgatgtagtgttcttgattactaagtat
ggttatatccacctctatgatcttgagactggtacctgtatctacatgaatagaatcagt
ggagaaacaatctttgttactgcacctcatgaagccacagctggaataattggagtaaac
agaaagggacaagttctgtcagtatgcgtggaagaagaaaacataattccttatatcacc
aatgtcctacaaaatcctgatttggctctgagaatggctgtacgtaataacttagctggt
gctgaagaactctttgcccggaaatttaatgctctttttgcccagggaaattactcagag
gcagcaaaggtagctgctaatgcaccaaagggaatccttcgtactccagacactatccgt
cggttccagagtgtcccagcccagccaggccaaacttctcctctacttcagtactttgga
attctcttggaccagggccaactaaacaaatatgaatccttagaactatgtaggcctgta
cttcagcaaggacggaaacagcttttggagaaatggttaaaagaagataagctggaatgt
tctgaagaactgggtgatcttgtgaaatctgtggaccctaccttggcacttagtgtgtac
ctgagggctaacgtcccaaataaagtaattcagtgctttgcagaaacaggtcaagtccag
aagattgttttatatgctaaaaaagttggatatactccagactggatatttttgctgaga
aatgtcatgcgtatcagtccagatcagggacagcagtttgctcaaatgttagttcaggat
gaagaaccacttgctgatatcacacagattgtggatgtctttatggaatacaatctaatt
cagcagtgtactgcattcttgcttgatgccctgaagaataatcgcccatctgaaggtcct
ttacagacacggttgcttgagatgaaccttatgcatgcacctcaggttgcagatgctatt
ctagggaatcagatgtttacacattatgaccgggctcatattgctcagctgtgtgaaaag
gctggtctactgcagcgtgcattagaacacttcactgatttatatgacataaagcgtgca
gttgttcacacccatcttcttaaccctgagtggttagtgaattactttgggtccttatca
gtagaagactccctagaatgcctcagggccatgctgtctgccaatattcgtcagaatctg
cagatctgtgttcaagtggcttccaagtatcatgaacaactgtcaactcaatctctgatt
gaactttttgaatctttcaagagttttgaaggtctcttttattttcttggatccattgtt
aactttagtcaggacccagatgtgcactttaagtatattcaggcagcttgcaagactggg
cagatcaaagaagtagaaagaatctgcagagaaagcaactgctatgatcctgagcgagtc
aagaattttctcaaggaagcgaagctaacagatcagttaccacttatcattgtgtgtgat
cggtttgactttgttcatgatttggtgctctatttatatagaaataatcttcaaaagtat
atagagatatatgtacagaaggtgaatccgagtcgacttcctgtggttattggaggattg
cttgatgttgattgctctgaagatgtcattaaaaatttgattcttgttgtaagaggtcaa
ttctctactgatgagcttgtagctgaggttgaaaaaagaaacagattgaaactgcttctg
ccttggctagaggccagaattcatgagggctgtgaggagcctgctactcacaacgcatta
gccaaaatctacatagacagtaataacaacccagagagatttcttcgtgaaaatccttat
tatgacagtcgtgttgttggaaagtattgtgagaagagagatccacatttggcttgtgtt
gcttatgaacgtggccagtgtgatctggaacttattaatgtttgcaatgagaattccctc
ttcaaaagtctttcccgctatttggtacgccgaaaggatccagaattatggggtagtgtg
ctgctggaaagtaatccttacaggagaccccttattgaccaggttgtacagacagccttg
tctgaaactcaggaccctgaagaagtgtcagtaactgtcaaggcttttatgactgcagac
cttcctaatgaactcattgaactgctggagaaaattgtccttgataactctgtattcagt
gaacacaggaatttgcaaaacctcctcatcctcactgcaatcaaggctgaccgtacacgt
gttatggagtatattaaccgcctggataattatgatgccccagatattgccaatatcgca
atctgcaatgagttgtttgaagaagcatttgccattttccggaaatttgatgtcaatact
tcagcagtgcaggtcttgattgaacatattggaaacttggaccgggcatatgagtttgct
gaacgctgcaatgaaccagcggtctggagtcagcttgcaaaagcccagttgcagaaagga
atggtgaaagaagccattgattcttacatcaaagcggatgatccttcatcctacatggaa
gttgttcaggctgccaacaccagtggaaactgggaagaactagtgaagtacttgcagatg
gcccgtaagaaggctcgtgaatcctatgtggagacagaattgatatttgcactggctaaa
acaaaccgccttgcagagttggaagagttcatcaatgggccaaataatgctcatatccaa
caagttggtgatcgttgttatgatgaaaaaatgtatgatgctgctaaattactgtacaac
aatgtctccaattttggacgcttggcatctaccctcgttcacctgggtgaatatcaggca
gctgttgatggagctaggaaagctaatagtactcgaacatggaaagaggtctgcttcgcc
tgtgtagatggcaaggagttccgtctagctcaaatgtgtgggcttcatattgtagtacat
gcagatgaattggaggaacttatcaactactatcaggaccgaggatactttgaagaactg
ataaccatgttggaagcagcactgggacttgagcgagctcatatgggaatgtttaccgaa
ttagctattctatattctaaatttaagccacagaaaatgagggagcatctggagctgttc
tggtccagagtgaatattcctaaggtgcttagagctgcagaacaagctcatctctgggca
gaattggtgtttttgtatgacaagtatgaagagtatgataatgccataattactatgatg
aaccatccaactgatgcatggaaagaagggcagttcaaagatattattaccaaggttgcc
aatgtggaactatactacagagcaatacagttctacctagaattcaagcctctgttgtta
aatgatttgctgatggtgctgtctccacggttggatcatactcgtgctgtcaattatttc
agcaaggttaaacagctaccactggtgaaaccatatttgcgttcagttcaaaaccacaac
aacaagtctgtgaatgaatcactgaacaacctctttattaccgaagaagattatcaggct
ctgcgaacatctatagatgcttatgacaactttgacaatatctcacttgctcagcgtttg
gaaaaacatgaactcattgagttcagaagaattgctgcttatctcttcaaaggcaacaac
cgctggaaacagagtgtagagctgtgcaagaaagacagcctgtacaaggatgcaatgcag
tatgcctctgaatctaaagatactgaattggctgaagaactcctacagtggtttttgcag
gaagaaaaaagagagtgctttggagcttgtctttttacctgttatgatcttttaaggcca
gatgttgtccttgaaactgcatggaggcacaatatcatggattttgccatgccctatttc
atccaggtcatgaaggaatacttgacaaaggtggataaattagatgcttcggaatcactg
agaaaagaagaagaacaagctacagagacgcaacctatcgtttatggtcagccccagttg
atgctgacagcaggacccagtgttgcagtccctccccaggcaccttttggctatggttat
actgcaccaccctatgggcagccacagcctggctttgggtacagcatgtga

KEGG   Felis catus (domestic cat): 101088646Help
Entry
101088646         CDS       T02385                                 

Gene name
CLTB
Definition
(RefSeq) clathrin light chain B isoform X2
  KO
K04645  clathrin light chain B
Organism
fca  Felis catus (domestic cat)
Pathway
fca04142  Lysosome
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
fca05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101088646 (CLTB)
   04142 Lysosome
    101088646 (CLTB)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101088646 (CLTB)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101088646 (CLTB)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101088646 (CLTB)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101088646 (CLTB)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101088646 (CLTB)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    101088646 (CLTB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q
Motif
Other DBs
NCBI-GeneID: 101088646
NCBI-ProteinID: XP_006927970
UniProt: A0A2I2UNI9
Position
A1
AA seq 211 aa AA seqDB search
MADDFGFFSSSESGAPEAAEEDPAAAFLAQQESEIAGIENDEGFGAPAGSHAALSQLGPA
SGAGSEDMGTTINGDVFQEANGPADGYAAIAQADRLTQEPESIRKWREEQRKRLQELDAA
SKVTEQEWREKAKKDLEEWNQRQSEQVEKNKINNRASEEAFVKESKEETPGTEWEKVAQL
CDFNPKSSKQCKDVSRLRSVLMSLKQTPLSR
NT seq 636 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgactttggcttcttctcgtcgtcggagagcggggcgcccgaggcggcggag
gaggacccggcggctgccttcctggcccagcaggagagtgagatcgcgggcatagagaat
gacgagggcttcggggcacctgccggcagccatgcggccctctcccagctgggacctgcg
agtggggctggttctgaggacatggggaccaccatcaatggagatgtgtttcaggaagct
aacggtccagcagacggctatgcggcgattgcccaggctgacagactgactcaggaacct
gagagcatccgcaagtggagagaggagcagaggaaacggctgcaggagctggatgctgcc
tccaaggtgacagaacaggagtggcgggagaaagccaaaaaggacctggaggagtggaac
cagcgccagagtgaacaagttgagaagaacaagatcaacaaccgggcatctgaggaggct
ttcgtgaaggaatccaaggaggagaccccaggcacagaatgggagaaggtggctcagctg
tgtgatttcaaccccaagagcagcaagcagtgcaaagacgtgtcccgcctgcgctcagtg
ctcatgtccctgaagcagacgccgctgtcccgctag

KEGG   Felis catus (domestic cat): 101097521Help
Entry
101097521         CDS       T02385                                 

Gene name
CLTA
Definition
(RefSeq) clathrin light chain A isoform X4
  KO
K04644  clathrin light chain A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04142  Lysosome
fca04144  Endocytosis
fca04721  Synaptic vesicle cycle
fca04961  Endocrine and other factor-regulated calcium reabsorption
fca05016  Huntington disease
fca05100  Bacterial invasion of epithelial cells
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101097521 (CLTA)
   04142 Lysosome
    101097521 (CLTA)
 09150 Organismal Systems
  09155 Excretory system
   04961 Endocrine and other factor-regulated calcium reabsorption
    101097521 (CLTA)
  09156 Nervous system
   04721 Synaptic vesicle cycle
    101097521 (CLTA)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05016 Huntington disease
    101097521 (CLTA)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101097521 (CLTA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101097521 (CLTA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101097521 (CLTA)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Clathrin
    101097521 (CLTA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of hepatic cells
   101097521 (CLTA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Clathrin_lg_ch CENP-Q ORC3_N
Motif
Other DBs
NCBI-GeneID: 101097521
NCBI-ProteinID: XP_003995672
Ensembl: ENSFCAG00000012764
UniProt: M3WHJ6
Position
D4
AA seq 218 aa AA seqDB search
MAELDPFGAPAGAPGGPALGNGVAGAGEEDPAAAFLAQQESEIAGIENDEAFAILDGGAP
GPQPHGEPPGGPDAVDGVMNGEYYQESNGPTDSYAAISQVDRLQSEPESIRKWREEQTER
LEALDANSRKQEAEWKEKAIKELEEWYARQDEQLQKTKANNRAAEEAFVNDIDESSPGTE
WERVARLCDFNPKSSKQAKDVSRMRSVLISLKQAPLVH
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggctgaactagatccgttcggcgcccccgccggcgccccgggcggccccgcgctgggg
aacggggtggccggtgccggcgaagaagacccggccgcggccttcttggcgcagcaggag
agcgagattgcgggcatcgagaacgacgaggccttcgccatcctggacggcggtgccccc
gggccccagccgcacggcgagccgccggggggtccggatgctgttgatggagtgatgaat
ggcgaatactaccaggagagtaatggtccaacagacagttacgcagctatttcacaagtg
gatcgcttgcagtcagagcctgaaagtatccgtaagtggagagaagagcaaacggaacgc
ttggaagcccttgatgccaattctcggaagcaagaagcagagtggaaagaaaaagcaata
aaggagctagaagagtggtatgcgaggcaggacgagcagctacagaaaacaaaagcaaat
aacagggcagcagaagaagcctttgtaaacgacatagacgagtcgtccccaggcactgag
tgggaacgggtggcccggctgtgtgactttaaccccaagtccagcaagcaggccaaagac
gtctcccgcatgcgctctgtcctcatctccctcaagcaggcccccctggtgcactga

DBGET integrated database retrieval system