KEGG   Felis catus (domestic cat): 101081273
Entry
101081273         CDS       T02385                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X2
  KO
K08526  retinoid X receptor gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca03320  PPAR signaling pathway
fca04659  Th17 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05216  Thyroid cancer
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05226  Gastric cancer
fca05417  Lipid and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101081273 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101081273 (RXRG)
   03320 PPAR signaling pathway
    101081273 (RXRG)
   04919 Thyroid hormone signaling pathway
    101081273 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    101081273 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081273 (RXRG)
   05202 Transcriptional misregulation in cancer
    101081273 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    101081273 (RXRG)
   05216 Thyroid cancer
    101081273 (RXRG)
   05222 Small cell lung cancer
    101081273 (RXRG)
   05223 Non-small cell lung cancer
    101081273 (RXRG)
  09166 Cardiovascular disease
   05417 Lipid and atherosclerosis
    101081273 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101081273 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    101081273 (RXRG)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101081273 (RXRG)
Nuclear receptors [BR:fca03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101081273 (RXRG)
SSDB
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Other DBs
NCBI-GeneID: 101081273
NCBI-ProteinID: XP_003999584
Ensembl: ENSFCAG00000010759
UniProt: M3WDW0
Position
F1
AA seq 463 aa
MYGNYSHFMKFPAGFGGSPGHSSSTSMSPLTALSTGKPMDSHPNYTDTPVSAPRTLSAVG
TPLNALGSPYRVIASAMGPPSGALAAPAGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKAELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt   +upstreamnt  +downstreamnt
atgtatgggaattattctcacttcatgaagtttcccgcaggctttggcggctcccccggc
cactccagctccacgtctatgagcccattgacagccttgtccacagggaagccaatggac
agccaccccaactacacggacacccccgtgagtgccccacggactctgagcgcggtgggg
acacccctcaatgccctgggctctccatatagagtcatcgcctctgccatgggcccaccc
tcaggagcactggctgcgcctgcgggaatcaatctggttgccccgcccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcccttaccagggcttcctggg
attggaaacatgaactacccatcaaccagccccggatccctggttaaacacatctgtgcc
atctgcggggacagatcctcaggaaagcactatggtgtgtatagctgtgaaggctgcaaa
ggcttcttcaagagaaccatacgcaaggacctcatgtacacatgccgggataacaaggac
tgcctcattgacaagcgtcagcggaatcgctgtcagtactgccgctaccagaagtgcctg
gtgatgggcatgaagagagaagctgtgcaagaagaaaggcagaggagccgggagcgggcc
gagagtgaggccgaatgtgccagtagtggccacgaagatatgcctgtggagaggattcta
gaagctgagcttgctgttgaaccaaagacggaatcctatggtgacatgaatatggagaac
tcgacgaacgaccctgtcacgaacatatgccatgctgctgataagcagcttttcactctt
gtcgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatc
ctgctccgggcagggtggaacgaactgctaattgcctccttctcccaccgctccgtctcc
gtgcaggacggcatccttctggccaccggcttacatgtccaccgcagcagcgcccacagc
gctggggtcggctccatctttgacagagtcctgactgagctggtctccaaaatgaaagac
atgcagatggacaaggcggagctggggtgcctgcgggccatcgtgctgtttaacccagat
gccaagggtctgtccaacccctcggaggtagagactctgcgagagaaggtttatgccacc
ctcgaggcctacacgaagcagaagtatccggaacaacctggcaggtttgccaagctgctg
ctgcgcctcccggccctgcgctccattggcctgaagtgcctggagcacctgtttttcttc
aagctcatcggggacacgcccattgacaccttcctcatggagatgttggagaccccgctg
caaatcacctga

DBGET integrated database retrieval system