KEGG   Felis catus (domestic cat): 101081273Help
Entry
101081273         CDS       T02385                                 

Gene name
RXRG
Definition
(RefSeq) retinoic acid receptor RXR-gamma isoform X2
  KO
K08526  retinoid X receptor gamma
Organism
fca  Felis catus (domestic cat)
Pathway
fca03320  PPAR signaling pathway
fca04659  Th17 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05216  Thyroid cancer
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101081273 (RXRG)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101081273 (RXRG)
   03320 PPAR signaling pathway
    101081273 (RXRG)
   04919 Thyroid hormone signaling pathway
    101081273 (RXRG)
   04928 Parathyroid hormone synthesis, secretion and action
    101081273 (RXRG)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081273 (RXRG)
   05202 Transcriptional misregulation in cancer
    101081273 (RXRG)
  09162 Cancer: specific types
   05226 Gastric cancer
    101081273 (RXRG)
   05216 Thyroid cancer
    101081273 (RXRG)
   05222 Small cell lung cancer
    101081273 (RXRG)
   05223 Non-small cell lung cancer
    101081273 (RXRG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101081273 (RXRG)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    101081273 (RXRG)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101081273 (RXRG)
Nuclear receptors [BR:fca03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101081273 (RXRG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 101081273
NCBI-ProteinID: XP_003999584
Ensembl: ENSFCAG00000010759
UniProt: M3WDW0
Position
F1
AA seq 463 aa AA seqDB search
MYGNYSHFMKFPAGFGGSPGHSSSTSMSPLTALSTGKPMDSHPNYTDTPVSAPRTLSAVG
TPLNALGSPYRVIASAMGPPSGALAAPAGINLVAPPSSQLNVVNSVSISEDIKPLPGLPG
IGNMNYPSTSPGSLVKHICAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLMYTCRDNKD
CLIDKRQRNRCQYCRYQKCLVMGMKREAVQEERQRSRERAESEAECASSGHEDMPVERIL
EAELAVEPKTESYGDMNMENSTNDPVTNICHAADKQLFTLVEWAKRIPHFSDLTLEDQVI
LLRAGWNELLIASFSHRSVSVQDGILLATGLHVHRSSAHSAGVGSIFDRVLTELVSKMKD
MQMDKAELGCLRAIVLFNPDAKGLSNPSEVETLREKVYATLEAYTKQKYPEQPGRFAKLL
LRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLETPLQIT
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgtatgggaattattctcacttcatgaagtttcccgcaggctttggcggctcccccggc
cactccagctccacgtctatgagcccattgacagccttgtccacagggaagccaatggac
agccaccccaactacacggacacccccgtgagtgccccacggactctgagcgcggtgggg
acacccctcaatgccctgggctctccatatagagtcatcgcctctgccatgggcccaccc
tcaggagcactggctgcgcctgcgggaatcaatctggttgccccgcccagctctcagcta
aatgtggtcaacagtgtcagcatttcagaggacatcaagcccttaccagggcttcctggg
attggaaacatgaactacccatcaaccagccccggatccctggttaaacacatctgtgcc
atctgcggggacagatcctcaggaaagcactatggtgtgtatagctgtgaaggctgcaaa
ggcttcttcaagagaaccatacgcaaggacctcatgtacacatgccgggataacaaggac
tgcctcattgacaagcgtcagcggaatcgctgtcagtactgccgctaccagaagtgcctg
gtgatgggcatgaagagagaagctgtgcaagaagaaaggcagaggagccgggagcgggcc
gagagtgaggccgaatgtgccagtagtggccacgaagatatgcctgtggagaggattcta
gaagctgagcttgctgttgaaccaaagacggaatcctatggtgacatgaatatggagaac
tcgacgaacgaccctgtcacgaacatatgccatgctgctgataagcagcttttcactctt
gtcgaatgggccaagcgcatcccccacttctctgacctcaccttggaggaccaggtcatc
ctgctccgggcagggtggaacgaactgctaattgcctccttctcccaccgctccgtctcc
gtgcaggacggcatccttctggccaccggcttacatgtccaccgcagcagcgcccacagc
gctggggtcggctccatctttgacagagtcctgactgagctggtctccaaaatgaaagac
atgcagatggacaaggcggagctggggtgcctgcgggccatcgtgctgtttaacccagat
gccaagggtctgtccaacccctcggaggtagagactctgcgagagaaggtttatgccacc
ctcgaggcctacacgaagcagaagtatccggaacaacctggcaggtttgccaagctgctg
ctgcgcctcccggccctgcgctccattggcctgaagtgcctggagcacctgtttttcttc
aagctcatcggggacacgcccattgacaccttcctcatggagatgttggagaccccgctg
caaatcacctga

KEGG   Felis catus (domestic cat): 101085757Help
Entry
101085757         CDS       T02385                                 

Gene name
RXRA
Definition
(RefSeq) retinoic acid receptor RXR-alpha isoform X2
  KO
K08524  retinoid X receptor alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca03320  PPAR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04659  Th17 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04976  Bile secretion
fca05160  Hepatitis C
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05216  Thyroid cancer
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101085757 (RXRA)
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101085757 (RXRA)
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101085757 (RXRA)
   03320 PPAR signaling pathway
    101085757 (RXRA)
   04919 Thyroid hormone signaling pathway
    101085757 (RXRA)
   04928 Parathyroid hormone synthesis, secretion and action
    101085757 (RXRA)
  09154 Digestive system
   04976 Bile secretion
    101085757 (RXRA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085757 (RXRA)
   05202 Transcriptional misregulation in cancer
    101085757 (RXRA)
  09162 Cancer: specific types
   05226 Gastric cancer
    101085757 (RXRA)
   05216 Thyroid cancer
    101085757 (RXRA)
   05222 Small cell lung cancer
    101085757 (RXRA)
   05223 Non-small cell lung cancer
    101085757 (RXRA)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101085757 (RXRA)
  09172 Infectious disease: viral
   05160 Hepatitis C
    101085757 (RXRA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101085757 (RXRA)
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    101085757 (RXRA)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101085757 (RXRA)
Nuclear receptors [BR:fca03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101085757 (RXRA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep Nuc_recep-AF1 zf-C4
Motif
Other DBs
NCBI-GeneID: 101085757
NCBI-ProteinID: XP_006939679
Ensembl: ENSFCAG00000002431
UniProt: A0A2I2U0T0
Position
D4
AA seq 476 aa AA seqDB search
MTHAGPPRVTPALSSGSWDFSTQVNSSSLNSPTGRGSMAAPSLHPSLGPGIGSSLGSPGQ
LHSPISTLSPPINGMGPPFSVISSPMGPHSMSVPTTPTLGFGTSSPQLSSPMNPVSSSED
IKPPLGLNGVLKVPAHPSGNMASFTKHICAICGDRSSGKHYGVYSCEGCKGFFKRTVRKD
LTYTCRDNKDCLIDKRQRNRCQYCRYQKCLAMGMKREAVQEERQRGKDRNENEVESTSSA
NEDMPVEKILEAELAVEPKTETYVDANMGLNPNSPNDPVTNICQAADKQLFTLVEWAKRI
PHFSELPLDDQVILLRAGWNELLIASFSHRSIAVKDGILLATGLHVHRNSAHSAGVGAIF
DRVLTELVSKMRDMQMDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKH
KYPEQPGRFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQMT
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgctggcccaccgcgtgttacaccagctctgagctctggttcctgggatttc
tccacccaggtgaactcctcttccctcaactcccccacggggcgtggctccatggccgcc
ccctcgctgcacccctctctggggcccggcatcggctcctcgctcggctcccccggccag
ctgcactcgcccatcagcaccctgagcccccccatcaacggcatgggcccaccgttctcg
gtcatcagctcccccatgggcccccactccatgtcagtgcccaccacgcccaccctgggc
ttcggcaccagcagcccccagctcagctcgcccatgaaccccgtcagcagcagcgaggac
atcaagcccccactgggcctcaatggtgtcctcaaagtcccggcccacccctcagggaac
atggcgtccttcaccaagcacatctgtgccatctgcggggaccgctcctcaggcaagcac
tacggggtgtacagctgcgagggctgcaagggcttcttcaagcggacggtgcgcaaggac
ctgacctacacctgccgggacaacaaggactgtctgatcgacaagcggcaacgcaaccgc
tgccagtactgccgctaccagaagtgcctggccatgggcatgaagcgcgaagccgtgcag
gaggagaggcagcggggcaaggaccggaacgagaacgaggtggagtccaccagcagtgcc
aacgaggacatgccggtggagaagattctggaggcggagctggccgtcgagcccaagacc
gagacgtacgtggacgcgaacatggggctgaaccccaactcgcccaacgaccccgtcacc
aacatctgccaggcagccgacaagcagctctttaccctggtcgagtgggccaagaggatc
ccgcacttctcagagctgcccctggacgaccaggtcatcctgctgagggcaggctggaac
gaactgctcatcgcctccttctcccaccggtccatcgccgtgaaggacgggatcctcctg
gccaccgggctgcacgtccaccggaacagcgcccacagcgccggggtgggcgcgatcttt
gacagggtgctgacggagctcgtgtccaagatgcgggacatgcagatggacaagacggag
ctgggctgcctgcgcgccatcgtcctcttcaaccccgactccaaggggctctcgaaccca
gcggaggtggaggccctgcgggagaaggtctacgcgtccctggaggcatactgcaagcac
aagtacccggagcagccgggaaggttcgccaagctgctgctgcgccttcctgctctgcgc
tccatcggcctcaagtgcctggaacacctttttttcttcaaactcatcggggacacgccc
atcgacaccttcctcatggagatgctggaagctccacaccaaatgacttag

KEGG   Felis catus (domestic cat): 101085801Help
Entry
101085801         CDS       T02385                                 

Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X1
  KO
K08525  retinoid X receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca03320  PPAR signaling pathway
fca04659  Th17 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05216  Thyroid cancer
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    101085801
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    101085801
   03320 PPAR signaling pathway
    101085801
   04919 Thyroid hormone signaling pathway
    101085801
   04928 Parathyroid hormone synthesis, secretion and action
    101085801
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101085801
   05202 Transcriptional misregulation in cancer
    101085801
  09162 Cancer: specific types
   05226 Gastric cancer
    101085801
   05216 Thyroid cancer
    101085801
   05222 Small cell lung cancer
    101085801
   05223 Non-small cell lung cancer
    101085801
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101085801
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    101085801
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    101085801
Nuclear receptors [BR:fca03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   101085801
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Motif
Other DBs
NCBI-GeneID: 101085801
NCBI-ProteinID: XP_023109557
Ensembl: ENSFCAG00000006981
Position
B2
AA seq 589 aa AA seqDB search
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGAPPPSPPGLPLPPSAAPTLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQVRGRGSLTASPLSFPCFPCD
PRSLCELPHGPLTFQSSNPGRPVVLVRPLALPEINSTVSLPGGGSGPPEDVKPPVLGVRG
LHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCT
VDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAE
LAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQ
VILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRSLSRVLTEL
VSKMRDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQG
RFAKLLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcctcccggtggcggcggcgacgg
ccctggctggatcccgcggcggcggcggcggcggcggcagccggagaacaacaaaccccg
gagccggagccaggggaggctggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagttcctccccgaatccccttccccagggggcccctcccccttctcctcct
ggcctacccctacccccttcagcagccccaacccttggaggttccggggccccaccccca
cccccaatgccaccccctccactgggctcccctttcccagtcatcagctcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccag
gtgagaggtcgtggctcactgactgcctctccactttcatttccttgttttccttgtgac
cccagatccttgtgtgaacttccccatggcccactgaccttccagtcctctaatcctggc
aggcctgtggtccttgtgagaccccttgcccttcctgagattaactcaacagtgtcgctc
cctgggggtgggtctggcccccctgaagatgtgaagccaccagtcttaggggtccggggc
ctgcactgtccaccccctccaggtggccctggggctggtaaacggctatgtgcaatctgc
ggggaccgaagctcaggcaaacactacggggtttacagctgtgagggctgcaaaggcttc
ttcaagcggaccatccgtaaggacctgacctactcgtgccgggacaacaaggactgcaca
gtggacaagcgccagcgaaaccgctgtcagtactgccgttatcagaagtgcctggccact
ggcatgaagagggaggcggtacaggaggaacgtcagcgggggaaggacaaggacggggat
ggggagggggctgggggagcccccgaggagatgcctgtggacaggatcctggaggcagag
cttgccgtggagcagaagagtgaccagggcgttgagggtcctgggggaaccgggggtagc
ggcagcagcccaaatgaccccgtgactaacatctgtcaggcagctgacaaacagctattc
acgcttgttgagtgggcgaagaggatcccacatttttcttccttgcctctggatgaccag
gtcatattgctacgggcaggctggaacgagctcctcattgcttccttctcccaccgatcc
attgatgtccgagatggcatcctcctcgccacaggtcttcatgtgcaccgcaactcagcc
cattctgcaggcgtgggagccatctttgatcggtccctctccagggtgctgacagagcta
gtgtccaaaatgcgtgacatgaggatggacaagacagagcttggctgcctgagggcaatc
attctgttcaatccagatgccaagggtctctccaaccccagtgaggtggaggttctgagg
gagaaagtgtacgcatcactggagacctactgcaaacagaagtaccctgagcagcaggga
cggtttgccaagctgctgctacgtcttcctgccctcaggtccatcggccttaagtgtcta
gaacatctgtttttcttcaagctcattggagacacccccattgacaccttcctcatggag
atgcttgaggctccccaccagctggcctga

KEGG   Felis catus (domestic cat): 111556172Help
Entry
111556172         CDS       T02385                                 

Definition
(RefSeq) retinoic acid receptor RXR-beta isoform X2
  KO
K08525  retinoid X receptor beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca03320  PPAR signaling pathway
fca04659  Th17 cell differentiation
fca04919  Thyroid hormone signaling pathway
fca04920  Adipocytokine signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05200  Pathways in cancer
fca05202  Transcriptional misregulation in cancer
fca05216  Thyroid cancer
fca05222  Small cell lung cancer
fca05223  Non-small cell lung cancer
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09151 Immune system
   04659 Th17 cell differentiation
    111556172
  09152 Endocrine system
   04920 Adipocytokine signaling pathway
    111556172
   03320 PPAR signaling pathway
    111556172
   04919 Thyroid hormone signaling pathway
    111556172
   04928 Parathyroid hormone synthesis, secretion and action
    111556172
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111556172
   05202 Transcriptional misregulation in cancer
    111556172
  09162 Cancer: specific types
   05226 Gastric cancer
    111556172
   05216 Thyroid cancer
    111556172
   05222 Small cell lung cancer
    111556172
   05223 Non-small cell lung cancer
    111556172
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    111556172
  09183 Protein families: signaling and cellular processes
   03310 Nuclear receptors [BR:fca03310]
    111556172
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys4 hepatocyte nuclear factor 4-like
    111556172
Nuclear receptors [BR:fca03310]
 2. Hepatocyte nuclear factor 4 like
  2B. Retinoid X receptor (RXR)
   111556172
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hormone_recep zf-C4 Nuc_recep-AF1
Motif
Other DBs
NCBI-GeneID: 111556172
NCBI-ProteinID: XP_011280573
Position
B2
AA seq 585 aa AA seqDB search
MSWAARPPFLPQRHAAGQCGPVGVRKEMHCGVASRWRRRRPWLDPAAAAAAAAAGEQQTP
EPEPGEAGRDGMGDSGRDSRSPDSSSPNPLPQGAPPPSPPGLPLPPSAAPTLGGSGAPPP
PPMPPPPLGSPFPVISSSMGSPGLPPPAPPGFSGPVSSPQVRGRGSLTASPLSFPCFPCD
PRSLCELPHGPLTFQSSNPGRPVVLVRPLALPEINSTVSLPGGGSGPPEDVKPPVLGVRG
LHCPPPPGGPGAGKRLCAICGDRSSGKHYGVYSCEGCKGFFKRTIRKDLTYSCRDNKDCT
VDKRQRNRCQYCRYQKCLATGMKREAVQEERQRGKDKDGDGEGAGGAPEEMPVDRILEAE
LAVEQKSDQGVEGPGGTGGSGSSPNDPVTNICQAADKQLFTLVEWAKRIPHFSSLPLDDQ
VILLRAGWNELLIASFSHRSIDVRDGILLATGLHVHRNSAHSAGVGAIFDRVLTELVSKM
RDMRMDKTELGCLRAIILFNPDAKGLSNPSEVEVLREKVYASLETYCKQKYPEQQGRFAK
LLLRLPALRSIGLKCLEHLFFFKLIGDTPIDTFLMEMLEAPHQLA
NT seq 1758 nt NT seq  +upstreamnt  +downstreamnt
atgtcttgggctgctcgcccgcccttcctcccccagcggcatgccgcagggcagtgtggg
ccggtgggggtgcgaaaagaaatgcattgtggggtcgcctcccggtggcggcggcgacgg
ccctggctggatcccgcggcggcggcggcggcggcggcagccggagaacaacaaaccccg
gagccggagccaggggaggctggacgggacgggatgggcgacagcgggcgggactcccga
agcccagacagttcctccccgaatccccttccccagggggcccctcccccttctcctcct
ggcctacccctacccccttcagcagccccaacccttggaggttccggggccccaccccca
cccccaatgccaccccctccactgggctcccctttcccagtcatcagctcttccatgggg
tcccctggtctgccccctccagctcccccaggattctccgggcctgtcagcagtccccag
gtgagaggtcgtggctcactgactgcctctccactttcatttccttgttttccttgtgac
cccagatccttgtgtgaacttccccatggcccactgaccttccagtcctctaatcctggc
aggcctgtggtccttgtgagaccccttgcccttcctgagattaactcaacagtgtcgctc
cctgggggtgggtctggcccccctgaagatgtgaagccaccagtcttaggggtccggggc
ctgcactgtccaccccctccaggtggccctggggctggtaaacggctatgtgcaatctgc
ggggaccgaagctcaggcaaacactacggggtttatagctgtgagggctgcaaaggcttc
ttcaagcggaccatccgtaaggacctgacctactcgtgccgggacaacaaggactgcaca
gtggacaagcgccagcgaaaccgctgtcagtactgccgttatcagaagtgcctggccact
ggcatgaagagggaggcggtacaggaggaacgtcagcgggggaaggacaaggacggggat
ggggagggggctgggggagcccccgaggagatgcctgtggacaggatcctggaggcagag
cttgccgtggagcagaagagtgaccagggcgttgagggtcctgggggaaccgggggtagc
ggcagcagcccaaatgaccccgtgactaacatctgtcaggcagctgacaaacagctattc
acgcttgttgagtgggcgaagaggatcccacatttttcttccttgcctctggatgaccag
gtcatattgctacgggcaggctggaacgagctcctcattgcttccttctcccaccgatcc
attgatgtccgagatggcatcctcctcgccacaggtcttcatgtgcaccgcaactcagcc
cattctgcaggcgtgggagccatctttgatcgggtgctgacagagctagtgtccaaaatg
cgtgacatgaggatggacaagacagagcttggctgcctgagggcaatcattctgttcaat
ccagatgccaagggtctctccaaccccagtgaggtggaggttctgagggagaaagtgtac
gcatcactggagacctactgcaaacagaagtaccctgagcagcagggacggtttgccaag
ctgctgctacgtcttcctgccctcaggtccatcggccttaagtgtctagaacatctgttt
ttcttcaagctcattggagacacccccattgacaccttcctcatggagatgcttgaggct
ccccaccagctggcctga

DBGET integrated database retrieval system