KEGG   Felis catus (domestic cat): 101081371Help
Entry
101081371         CDS       T02385                                 

Definition
(RefSeq) interferon alpha-like
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101081371
   04151 PI3K-Akt signaling pathway
    101081371
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101081371
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101081371
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101081371
   04621 NOD-like receptor signaling pathway
    101081371
   04622 RIG-I-like receptor signaling pathway
    101081371
   04623 Cytosolic DNA-sensing pathway
    101081371
   04650 Natural killer cell mediated cytotoxicity
    101081371
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081371
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101081371
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101081371
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101081371
   05162 Measles
    101081371
   05164 Influenza A
    101081371
   05161 Hepatitis B
    101081371
   05160 Hepatitis C
    101081371
   05168 Herpes simplex virus 1 infection
    101081371
   05163 Human cytomegalovirus infection
    101081371
   05167 Kaposi sarcoma-associated herpesvirus infection
    101081371
   05169 Epstein-Barr virus infection
    101081371
   05165 Human papillomavirus infection
    101081371
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101081371
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   101081371
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 101081371
NCBI-ProteinID: XP_004001317
Ensembl: ENSFCAG00000022104
UniProt: M3WSK5
Position
D4
AA seq 193 aa AA seqDB search
MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL
EACVVQEVGEGEAPLTNEDIHPEDSLLRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
SSTALQKRLRSEK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc
tctctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
catgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggacatt
catcccgaggactccctcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tcgtcaacagccttgcagaaaagattgaggagcgagaaatga

KEGG   Felis catus (domestic cat): 101088440Help
Entry
101088440         CDS       T02385                                 

Definition
(RefSeq) interferon alpha-2-like
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    101088440
   04151 PI3K-Akt signaling pathway
    101088440
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    101088440
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101088440
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101088440
   04621 NOD-like receptor signaling pathway
    101088440
   04622 RIG-I-like receptor signaling pathway
    101088440
   04623 Cytosolic DNA-sensing pathway
    101088440
   04650 Natural killer cell mediated cytotoxicity
    101088440
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101088440
  09163 Immune disease
   05320 Autoimmune thyroid disease
    101088440
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    101088440
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101088440
   05162 Measles
    101088440
   05164 Influenza A
    101088440
   05161 Hepatitis B
    101088440
   05160 Hepatitis C
    101088440
   05168 Herpes simplex virus 1 infection
    101088440
   05163 Human cytomegalovirus infection
    101088440
   05167 Kaposi sarcoma-associated herpesvirus infection
    101088440
   05169 Epstein-Barr virus infection
    101088440
   05165 Human papillomavirus infection
    101088440
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    101088440
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   101088440
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon MnmE_helical
Motif
Other DBs
NCBI-GeneID: 101088440
NCBI-ProteinID: XP_003995570
Ensembl: ENSFCAG00000023458
UniProt: M3WZS7
Position
D4
AA seq 183 aa AA seqDB search
MALSISVLLALVMLCSSPAYSLDCDLRPSNPETFTLLSQMERVSILSCLKDRTDFNFPQI
LVAGNQLEKTQVTAVVHEMLQQIFNLFSKSDSFVAWDEMLLDRFLVGLYQQLDDLETCLR
EEMNMEQLPLGNENSRLAVKRYFQGISLYLKEKEYSHCAWEVVRVEIRRCLLVINKLTGT
FRK
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atggctctctcaatctctgtgctgttggctctggtgatgctgtgctccagccccgcctac
tctctggactgtgacctgcgtccgagcaatccagaaaccttcacacttttgagtcaaatg
gagagagtctccattctgtcctgtctgaaggacaggactgacttcaactttcctcagata
cttgtggctgggaaccagcttgagaagacacaagtgacagctgtcgtgcatgagatgctc
cagcagatcttcaacctcttcagcaaaagcgactcctttgtggcttgggatgagatgctt
ctggacagattccttgttggactttaccaacagctggatgacctggagacgtgtttgagg
gaggaaatgaacatggaacagctacccctgggaaatgagaactccagactggctgtgaag
agatacttccaaggaatcagtctctatcttaaagagaaagaatacagccactgtgcctgg
gaggttgtcagggtagaaatcagaagatgcttgctcgtcattaacaagctcacagggaca
ttcaggaaataa

KEGG   Felis catus (domestic cat): 111557596Help
Entry
111557596         CDS       T02385                                 

Definition
(RefSeq) interferon alpha-like
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    111557596
   04151 PI3K-Akt signaling pathway
    111557596
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    111557596
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111557596
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    111557596
   04621 NOD-like receptor signaling pathway
    111557596
   04622 RIG-I-like receptor signaling pathway
    111557596
   04623 Cytosolic DNA-sensing pathway
    111557596
   04650 Natural killer cell mediated cytotoxicity
    111557596
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    111557596
  09163 Immune disease
   05320 Autoimmune thyroid disease
    111557596
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    111557596
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    111557596
   05162 Measles
    111557596
   05164 Influenza A
    111557596
   05161 Hepatitis B
    111557596
   05160 Hepatitis C
    111557596
   05168 Herpes simplex virus 1 infection
    111557596
   05163 Human cytomegalovirus infection
    111557596
   05167 Kaposi sarcoma-associated herpesvirus infection
    111557596
   05169 Epstein-Barr virus infection
    111557596
   05165 Human papillomavirus infection
    111557596
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    111557596
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   111557596
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 111557596
NCBI-ProteinID: XP_023099037
Position
D4
AA seq 193 aa AA seqDB search
MALPSSFLVALVALGCNSVCSLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSPKAQALSVVHVTNQKIFHFFCTGASSSAAWNTTLLEEFCTGLDRQLTRL
EACVVQEVGEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
SSTALQKRLRSEK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc
tctctgggttgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc
ttcccccaggacgtgtttggtggagaccagtcccccaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacaggggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctgacgaacgaggacatt
catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tcgtcaacagccttgcagaaaagattaaggagcgagaaatga

KEGG   Felis catus (domestic cat): 493648Help
Entry
493648            CDS       T02385                                 

Gene name
IFNA8
Definition
(RefSeq) interferon alpha-8 precursor
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    493648 (IFNA8)
   04151 PI3K-Akt signaling pathway
    493648 (IFNA8)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493648 (IFNA8)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493648 (IFNA8)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493648 (IFNA8)
   04621 NOD-like receptor signaling pathway
    493648 (IFNA8)
   04622 RIG-I-like receptor signaling pathway
    493648 (IFNA8)
   04623 Cytosolic DNA-sensing pathway
    493648 (IFNA8)
   04650 Natural killer cell mediated cytotoxicity
    493648 (IFNA8)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493648 (IFNA8)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493648 (IFNA8)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493648 (IFNA8)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493648 (IFNA8)
   05162 Measles
    493648 (IFNA8)
   05164 Influenza A
    493648 (IFNA8)
   05161 Hepatitis B
    493648 (IFNA8)
   05160 Hepatitis C
    493648 (IFNA8)
   05168 Herpes simplex virus 1 infection
    493648 (IFNA8)
   05163 Human cytomegalovirus infection
    493648 (IFNA8)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493648 (IFNA8)
   05169 Epstein-Barr virus infection
    493648 (IFNA8)
   05165 Human papillomavirus infection
    493648 (IFNA8)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493648 (IFNA8)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493648 (IFNA8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 493648
NCBI-ProteinID: NP_001009193
Ensembl: ENSFCAG00000007773
UniProt: Q863J0
Position
D4
AA seq 189 aa AA seqDB search
MALPSSFLVSLVALGCNSVCSLCCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL
EACVVQEVGEGEAPLTNEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLYYSSTA
LQKRLRSEK
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtgtccctggtggcgctgggctgcaactccgtctgc
tctctttgctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacaggaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattctgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcgtgcaggaggtgggggagggagaggctcccctcacgaacgaggactcc
atcctgaggaactacttccaaagactctccctctacctgcaagagaagaaatacagccct
tgtgcctgggagatcgtcagagcagaaatcatgagatccttgtattattcatcaacagcc
ttgcagaaaagattaaggagcgagaaatga

KEGG   Felis catus (domestic cat): 493653Help
Entry
493653            CDS       T02385                                 

Gene name
IFNA7
Definition
(RefSeq) interferon alpha precursor
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    493653 (IFNA7)
   04151 PI3K-Akt signaling pathway
    493653 (IFNA7)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493653 (IFNA7)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493653 (IFNA7)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493653 (IFNA7)
   04621 NOD-like receptor signaling pathway
    493653 (IFNA7)
   04622 RIG-I-like receptor signaling pathway
    493653 (IFNA7)
   04623 Cytosolic DNA-sensing pathway
    493653 (IFNA7)
   04650 Natural killer cell mediated cytotoxicity
    493653 (IFNA7)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493653 (IFNA7)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493653 (IFNA7)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493653 (IFNA7)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493653 (IFNA7)
   05162 Measles
    493653 (IFNA7)
   05164 Influenza A
    493653 (IFNA7)
   05161 Hepatitis B
    493653 (IFNA7)
   05160 Hepatitis C
    493653 (IFNA7)
   05168 Herpes simplex virus 1 infection
    493653 (IFNA7)
   05163 Human cytomegalovirus infection
    493653 (IFNA7)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493653 (IFNA7)
   05169 Epstein-Barr virus infection
    493653 (IFNA7)
   05165 Human papillomavirus infection
    493653 (IFNA7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493653 (IFNA7)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493653 (IFNA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 493653
NCBI-ProteinID: NP_001009197
Ensembl: ENSFCAG00000023542
UniProt: P35849
Position
D4
AA seq 194 aa AA seqDB search
MALPSSFLVALVALGCNSVCVLGCDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTEASSSAAWNTTLLEEFCTGLDRQLTRL
EACVLQEVEEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
YSSTALQKRLRSEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtctgc
gtgctgggctgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
ctgggacaaatgaggagactccctgccagctcctgtcagaaggacagaaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacagaggcgtcctcgtctgctgct
tggaacaccaccctcctggaggaattttgcacgggacttgatcggcagctgacccgcctg
gaagcctgtgtcctgcaggaggtggaggagggagaggctcccctgacgaacgaggacatt
catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tattcatcaacagccttgcagaaaagattaaggagcgagaaatga

KEGG   Felis catus (domestic cat): 493840Help
Entry
493840            CDS       T02385                                 

Gene name
IFNA5
Definition
(RefSeq) LOW QUALITY PROTEIN: interferon alpha-5
  KO
K05414  interferon alpha
Organism
fca  Felis catus (domestic cat)
Pathway
fca04060  Cytokine-cytokine receptor interaction
fca04151  PI3K-Akt signaling pathway
fca04217  Necroptosis
fca04620  Toll-like receptor signaling pathway
fca04621  NOD-like receptor signaling pathway
fca04622  RIG-I-like receptor signaling pathway
fca04623  Cytosolic DNA-sensing pathway
fca04630  Jak-STAT signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca05152  Tuberculosis
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05168  Herpes simplex virus 1 infection
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05320  Autoimmune thyroid disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04630 Jak-STAT signaling pathway
    493840 (IFNA5)
   04151 PI3K-Akt signaling pathway
    493840 (IFNA5)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    493840 (IFNA5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    493840 (IFNA5)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    493840 (IFNA5)
   04621 NOD-like receptor signaling pathway
    493840 (IFNA5)
   04622 RIG-I-like receptor signaling pathway
    493840 (IFNA5)
   04623 Cytosolic DNA-sensing pathway
    493840 (IFNA5)
   04650 Natural killer cell mediated cytotoxicity
    493840 (IFNA5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    493840 (IFNA5)
  09163 Immune disease
   05320 Autoimmune thyroid disease
    493840 (IFNA5)
  09171 Infectious disease: bacterial
   05152 Tuberculosis
    493840 (IFNA5)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    493840 (IFNA5)
   05162 Measles
    493840 (IFNA5)
   05164 Influenza A
    493840 (IFNA5)
   05161 Hepatitis B
    493840 (IFNA5)
   05160 Hepatitis C
    493840 (IFNA5)
   05168 Herpes simplex virus 1 infection
    493840 (IFNA5)
   05163 Human cytomegalovirus infection
    493840 (IFNA5)
   05167 Kaposi sarcoma-associated herpesvirus infection
    493840 (IFNA5)
   05169 Epstein-Barr virus infection
    493840 (IFNA5)
   05165 Human papillomavirus infection
    493840 (IFNA5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:fca04052]
    493840 (IFNA5)
Cytokines and growth factors [BR:fca04052]
 Cytokines
  Interferons
   493840 (IFNA5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Interferon
Motif
Other DBs
NCBI-GeneID: 493840
NCBI-ProteinID: XP_023099036
Position
D4
AA seq 194 aa AA seqDB search
MALPSSFLVALVALGCNSVLLFACDLPQTHGLLNRRALTLLGQMRRLPASSCQKDRNDFA
FPQDVFGGDQSHKAQALSVVHVTNQKIFHFFCTGASSSAAWNTTPPEGILARTDRQLTRL
EACVLQEVEEGEAPLTNEDIHPEDSILRNYFQRLSLYLQEKKYSPCAWEIVRAEIMRSLY
YSSIALQKRLRSEK
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atggcgctgccctcttccttcttggtggccctggtggcgctgggctgcaactccgtcttg
ctctttgcttgtgacctgcctcagacccacggcctgctgaacaggagggccttgacgctc
cttggacaaatgaggagactccctgccagctcctgtcagaaggacagaaatgacttcgcc
ttcccccaggacgtgttcggtggagaccagtcccacaaggcccaagccctctcggtggtg
cacgtgacgaaccagaagatcttccacttcttctgcacaggggcgtcctcgtctgctgct
tggaacaccacccctcctgagggaattcttgcacggactgatcggcagctgacccgcctg
gaagcctgtgtcctgcaggaggtggaggagggagaggctcccctgacaaacgaggacatt
catcccgaggactccatcctgaggaactacttccaaagactctccctctacctgcaagag
aagaaatacagcccttgtgcctgggagatcgtcagagcagaaatcatgagatccttgtat
tattcatcaatagccttgcagaaaagattaaggagcgagaaatga

DBGET integrated database retrieval system