KEGG   Felis catus (domestic cat): 101081387Help
Entry
101081387         CDS       T02385                                 

Gene name
MAP2K1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1 isoform X2
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04114  Oocyte meiosis
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04218  Cellular senescence
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04380  Osteoclast differentiation
fca04510  Focal adhesion
fca04540  Gap junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04620  Toll-like receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04668  TNF signaling pathway
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04725  Cholinergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca05020  Prion diseases
fca05034  Alcoholism
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05212  Pancreatic cancer
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
fca_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101081387 (MAP2K1)
   04015 Rap1 signaling pathway
    101081387 (MAP2K1)
   04010 MAPK signaling pathway
    101081387 (MAP2K1)
   04012 ErbB signaling pathway
    101081387 (MAP2K1)
   04370 VEGF signaling pathway
    101081387 (MAP2K1)
   04371 Apelin signaling pathway
    101081387 (MAP2K1)
   04668 TNF signaling pathway
    101081387 (MAP2K1)
   04066 HIF-1 signaling pathway
    101081387 (MAP2K1)
   04068 FoxO signaling pathway
    101081387 (MAP2K1)
   04072 Phospholipase D signaling pathway
    101081387 (MAP2K1)
   04071 Sphingolipid signaling pathway
    101081387 (MAP2K1)
   04024 cAMP signaling pathway
    101081387 (MAP2K1)
   04022 cGMP-PKG signaling pathway
    101081387 (MAP2K1)
   04151 PI3K-Akt signaling pathway
    101081387 (MAP2K1)
   04150 mTOR signaling pathway
    101081387 (MAP2K1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101081387 (MAP2K1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101081387 (MAP2K1)
   04210 Apoptosis
    101081387 (MAP2K1)
   04218 Cellular senescence
    101081387 (MAP2K1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101081387 (MAP2K1)
   04540 Gap junction
    101081387 (MAP2K1)
   04550 Signaling pathways regulating pluripotency of stem cells
    101081387 (MAP2K1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101081387 (MAP2K1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101081387 (MAP2K1)
   04650 Natural killer cell mediated cytotoxicity
    101081387 (MAP2K1)
   04660 T cell receptor signaling pathway
    101081387 (MAP2K1)
   04662 B cell receptor signaling pathway
    101081387 (MAP2K1)
   04664 Fc epsilon RI signaling pathway
    101081387 (MAP2K1)
   04666 Fc gamma R-mediated phagocytosis
    101081387 (MAP2K1)
   04062 Chemokine signaling pathway
    101081387 (MAP2K1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101081387 (MAP2K1)
   04912 GnRH signaling pathway
    101081387 (MAP2K1)
   04915 Estrogen signaling pathway
    101081387 (MAP2K1)
   04914 Progesterone-mediated oocyte maturation
    101081387 (MAP2K1)
   04917 Prolactin signaling pathway
    101081387 (MAP2K1)
   04921 Oxytocin signaling pathway
    101081387 (MAP2K1)
   04926 Relaxin signaling pathway
    101081387 (MAP2K1)
   04919 Thyroid hormone signaling pathway
    101081387 (MAP2K1)
   04928 Parathyroid hormone synthesis, secretion and action
    101081387 (MAP2K1)
   04916 Melanogenesis
    101081387 (MAP2K1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101081387 (MAP2K1)
  09156 Nervous system
   04725 Cholinergic synapse
    101081387 (MAP2K1)
   04726 Serotonergic synapse
    101081387 (MAP2K1)
   04720 Long-term potentiation
    101081387 (MAP2K1)
   04730 Long-term depression
    101081387 (MAP2K1)
   04722 Neurotrophin signaling pathway
    101081387 (MAP2K1)
  09158 Development
   04380 Osteoclast differentiation
    101081387 (MAP2K1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081387 (MAP2K1)
   05206 MicroRNAs in cancer
    101081387 (MAP2K1)
   05205 Proteoglycans in cancer
    101081387 (MAP2K1)
   05230 Central carbon metabolism in cancer
    101081387 (MAP2K1)
   05231 Choline metabolism in cancer
    101081387 (MAP2K1)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101081387 (MAP2K1)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101081387 (MAP2K1)
   05212 Pancreatic cancer
    101081387 (MAP2K1)
   05225 Hepatocellular carcinoma
    101081387 (MAP2K1)
   05226 Gastric cancer
    101081387 (MAP2K1)
   05214 Glioma
    101081387 (MAP2K1)
   05216 Thyroid cancer
    101081387 (MAP2K1)
   05221 Acute myeloid leukemia
    101081387 (MAP2K1)
   05220 Chronic myeloid leukemia
    101081387 (MAP2K1)
   05218 Melanoma
    101081387 (MAP2K1)
   05211 Renal cell carcinoma
    101081387 (MAP2K1)
   05219 Bladder cancer
    101081387 (MAP2K1)
   05215 Prostate cancer
    101081387 (MAP2K1)
   05213 Endometrial cancer
    101081387 (MAP2K1)
   05224 Breast cancer
    101081387 (MAP2K1)
   05223 Non-small cell lung cancer
    101081387 (MAP2K1)
  09164 Neurodegenerative disease
   05020 Prion diseases
    101081387 (MAP2K1)
  09165 Substance dependence
   05034 Alcoholism
    101081387 (MAP2K1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101081387 (MAP2K1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101081387 (MAP2K1)
   05170 Human immunodeficiency virus 1 infection
    101081387 (MAP2K1)
   05164 Influenza A
    101081387 (MAP2K1)
   05161 Hepatitis B
    101081387 (MAP2K1)
   05160 Hepatitis C
    101081387 (MAP2K1)
   05163 Human cytomegalovirus infection
    101081387 (MAP2K1)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101081387 (MAP2K1)
   05165 Human papillomavirus infection
    101081387 (MAP2K1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101081387 (MAP2K1)
   01522 Endocrine resistance
    101081387 (MAP2K1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101081387 (MAP2K1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101081387 (MAP2K1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE7 family
   101081387 (MAP2K1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Haspin_kinase Seadorna_VP7 Kinase-like NAD_binding_6
Motif
Other DBs
NCBI-GeneID: 101081387
NCBI-ProteinID: XP_003987067
Ensembl: ENSFCAG00000028389
Position
B3
AA seq 371 aa AA seqDB search
MKLERTNLEALQKKLEELELDEQQRKRLEAFLTQKQKVGELKDDDFEKISELGAGNGGVV
FKVSHKPSGLVMARKLIHLEIKPAIRNQIIRELQVLHECNSPYIVGFYGAFYSDGEISIC
MEHMDGGSLDQVLKKAGRIPEQILGKVSIAVIKGLTYLREKHKIMHRDVKPSNILVNSRG
EIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTHYSVQSDIWSMGLSLVEMAVGRYP
IPPPDAKELELMFGCQVEGDAAETPPRPRTPGRPLSSYGMDSRPPMAIFELLDYIVNEPP
PKLPSGVFSLEFQDFVNKCLIKNPAERADLKQLMVHAFIKRSDGEEVDFAGWLCSTIGLN
QPSTPTHAAGV
NT seq 1116 nt NT seq  +upstreamnt  +downstreamnt
atgaagctggagaggaccaacctggaggccttgcagaagaagctggaggagctggagctc
gatgagcagcaacggaagcgcctggaggcctttcttacccagaagcagaaggtcggggaa
ttgaaggatgacgacttcgagaagatcagcgagctgggcgctggcaacggtggtgtggtg
ttcaaggtctcccataagccgtctggcctggtcatggccagaaagctaattcacctggag
atcaaacctgcaatccggaaccagatcataagggagctgcaggttctacatgagtgcaac
tccccatacatcgtgggcttctatggcgcgttctacagcgacggcgagatcagtatctgt
atggagcacatggatgggggttccttggatcaagtcctgaagaaagctggaagaattcct
gaacaaattttaggaaaagttagcattgctgtaataaaaggtctgacatacctgagggag
aagcacaagattatgcacagagatgtcaagccttccaacatcctagtgaactctcgtggg
gagatcaagctctgtgactttggggtcagcgggcagctcatcgactccatggccaactcc
ttcgtgggcacaaggtcctacatgtcgccagaaagactccaggggactcattactccgtg
cagtcggacatctggagcatggggctatctctggttgagatggcagtcgggaggtatccc
atccctcctcccgatgccaaggagctggagctgatgtttgggtgccaagtggagggagat
gcggctgagacgccacccaggccgaggacccccggaaggcccctcagctcgtatggaatg
gacagccgacctcccatggcaatttttgagttgttggattacatagtcaacgagcctcct
ccaaagctgcccagtggagtattcagtctggaatttcaagattttgtgaataaatgcctc
ataaaaaacccagcagagagagcagatctgaaacaactcatggttcatgcctttatcaag
agatctgatggtgaggaagtggattttgcaggttggctctgctccaccatcggccttaac
cagcccagcacaccgacccacgcggccggcgtctaa

KEGG   Felis catus (domestic cat): 101100281Help
Entry
101100281         CDS       T02385                                 

Gene name
MAP2K2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2 isoform X1
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04010  MAPK signaling pathway
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04066  HIF-1 signaling pathway
fca04068  FoxO signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04140  Autophagy - animal
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04210  Apoptosis
fca04218  Cellular senescence
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04371  Apelin signaling pathway
fca04540  Gap junction
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04620  Toll-like receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04730  Long-term depression
fca04810  Regulation of actin cytoskeleton
fca04910  Insulin signaling pathway
fca04912  GnRH signaling pathway
fca04915  Estrogen signaling pathway
fca04916  Melanogenesis
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04921  Oxytocin signaling pathway
fca04926  Relaxin signaling pathway
fca04934  Cushing syndrome
fca05020  Prion diseases
fca05160  Hepatitis C
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05164  Influenza A
fca05165  Human papillomavirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05170  Human immunodeficiency virus 1 infection
fca05200  Pathways in cancer
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05211  Renal cell carcinoma
fca05213  Endometrial cancer
fca05214  Glioma
fca05215  Prostate cancer
fca05216  Thyroid cancer
fca05218  Melanoma
fca05219  Bladder cancer
fca05220  Chronic myeloid leukemia
fca05221  Acute myeloid leukemia
fca05223  Non-small cell lung cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
fca05230  Central carbon metabolism in cancer
fca05231  Choline metabolism in cancer
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Module
fca_M00687  MAPK (ERK1/2) signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101100281 (MAP2K2)
   04015 Rap1 signaling pathway
    101100281 (MAP2K2)
   04010 MAPK signaling pathway
    101100281 (MAP2K2)
   04012 ErbB signaling pathway
    101100281 (MAP2K2)
   04370 VEGF signaling pathway
    101100281 (MAP2K2)
   04371 Apelin signaling pathway
    101100281 (MAP2K2)
   04066 HIF-1 signaling pathway
    101100281 (MAP2K2)
   04068 FoxO signaling pathway
    101100281 (MAP2K2)
   04072 Phospholipase D signaling pathway
    101100281 (MAP2K2)
   04071 Sphingolipid signaling pathway
    101100281 (MAP2K2)
   04024 cAMP signaling pathway
    101100281 (MAP2K2)
   04022 cGMP-PKG signaling pathway
    101100281 (MAP2K2)
   04151 PI3K-Akt signaling pathway
    101100281 (MAP2K2)
   04150 mTOR signaling pathway
    101100281 (MAP2K2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101100281 (MAP2K2)
  09143 Cell growth and death
   04210 Apoptosis
    101100281 (MAP2K2)
   04218 Cellular senescence
    101100281 (MAP2K2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    101100281 (MAP2K2)
   04550 Signaling pathways regulating pluripotency of stem cells
    101100281 (MAP2K2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101100281 (MAP2K2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101100281 (MAP2K2)
   04650 Natural killer cell mediated cytotoxicity
    101100281 (MAP2K2)
   04660 T cell receptor signaling pathway
    101100281 (MAP2K2)
   04662 B cell receptor signaling pathway
    101100281 (MAP2K2)
   04664 Fc epsilon RI signaling pathway
    101100281 (MAP2K2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101100281 (MAP2K2)
   04912 GnRH signaling pathway
    101100281 (MAP2K2)
   04915 Estrogen signaling pathway
    101100281 (MAP2K2)
   04917 Prolactin signaling pathway
    101100281 (MAP2K2)
   04921 Oxytocin signaling pathway
    101100281 (MAP2K2)
   04926 Relaxin signaling pathway
    101100281 (MAP2K2)
   04919 Thyroid hormone signaling pathway
    101100281 (MAP2K2)
   04916 Melanogenesis
    101100281 (MAP2K2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101100281 (MAP2K2)
  09156 Nervous system
   04720 Long-term potentiation
    101100281 (MAP2K2)
   04730 Long-term depression
    101100281 (MAP2K2)
   04722 Neurotrophin signaling pathway
    101100281 (MAP2K2)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101100281 (MAP2K2)
   05206 MicroRNAs in cancer
    101100281 (MAP2K2)
   05205 Proteoglycans in cancer
    101100281 (MAP2K2)
   05230 Central carbon metabolism in cancer
    101100281 (MAP2K2)
   05231 Choline metabolism in cancer
    101100281 (MAP2K2)
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101100281 (MAP2K2)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101100281 (MAP2K2)
   05225 Hepatocellular carcinoma
    101100281 (MAP2K2)
   05226 Gastric cancer
    101100281 (MAP2K2)
   05214 Glioma
    101100281 (MAP2K2)
   05216 Thyroid cancer
    101100281 (MAP2K2)
   05221 Acute myeloid leukemia
    101100281 (MAP2K2)
   05220 Chronic myeloid leukemia
    101100281 (MAP2K2)
   05218 Melanoma
    101100281 (MAP2K2)
   05211 Renal cell carcinoma
    101100281 (MAP2K2)
   05219 Bladder cancer
    101100281 (MAP2K2)
   05215 Prostate cancer
    101100281 (MAP2K2)
   05213 Endometrial cancer
    101100281 (MAP2K2)
   05224 Breast cancer
    101100281 (MAP2K2)
   05223 Non-small cell lung cancer
    101100281 (MAP2K2)
  09164 Neurodegenerative disease
   05020 Prion diseases
    101100281 (MAP2K2)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101100281 (MAP2K2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101100281 (MAP2K2)
   05170 Human immunodeficiency virus 1 infection
    101100281 (MAP2K2)
   05164 Influenza A
    101100281 (MAP2K2)
   05161 Hepatitis B
    101100281 (MAP2K2)
   05160 Hepatitis C
    101100281 (MAP2K2)
   05163 Human cytomegalovirus infection
    101100281 (MAP2K2)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101100281 (MAP2K2)
   05165 Human papillomavirus infection
    101100281 (MAP2K2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101100281 (MAP2K2)
   01522 Endocrine resistance
    101100281 (MAP2K2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101100281 (MAP2K2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101100281 (MAP2K2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE7 family
   101100281 (MAP2K2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Pkinase_fungal Haspin_kinase Kinase-like APH Seadorna_VP7 Kdo
Motif
Other DBs
NCBI-GeneID: 101100281
NCBI-ProteinID: XP_023099673
Position
A2
AA seq 427 aa AA seqDB search
MLARRKPVLPALTINPAIAEGPSPTSEGASEANLVDLQKKLAELELDEQQKKRLEAFLTQ
KAKVGELKDDDFERISELGAGNGGVVTKVQHRPSGLIMARKLIHLEIKPAIRNQIIRELQ
VLHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEAKRIPEEILGKVSIAVLRG
LAYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQ
GTHYSVQSDIWSMGLSLVELSIGRYPIPPPDAKELEAIFGRPMVDGAEGEPHSISPRPRP
PGRPISGHGTDSRPAMAIFELLDYIVNEPPPKLPSGVFTQDFQEFVNKCLIKNPAERADL
KTLTPGEACSSGTSTTRDREGHTCWFSVSGAERPNTSVSQLPQRGLSKPHLHQAVRGTRS
GLRRLVV
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
atgctggcccggaggaagccggtgctgccggcgctcactatcaaccccgccatcgccgag
ggcccgtcccccaccagcgagggcgcctccgaagcaaacttggtggacctccagaagaag
ctagcggagcttgaactcgacgaacagcagaagaagcgtctggaagccttcctcacccag
aaggccaaggtcggagagctcaaggacgatgacttcgaaaggatctcggaactgggggcc
gggaacggcggggtggtcaccaaggtccaacacagaccctccggcctcatcatggcgaga
aagctgatccacctggagatcaagccggccatccggaaccagatcatccgcgagctgcag
gtgctgcacgagtgtaactccccgtacatcgtgggcttctacggggccttctacagcgac
ggcgagatcagcatctgcatggagcacatggacggcggctctctggaccaggtgttgaag
gaagccaagagaattcccgaggagatcctggggaaggtcagcatcgcggttctccggggt
ttggcgtatctccgggaaaagcaccagatcatgcaccgagacgtgaaaccgtccaacatc
ctcgtcaactcccgaggggagatcaagctgtgcgattttggggtgagcgggcagctcatc
gactccatggccaactccttcgtgggaactcggtcctacatgtctccagagcggttgcag
ggcactcactactcggtgcagtcggacatctggagcatgggcctgtccctggtggagctg
tccatcggaaggtaccccatccccccgccggatgccaaggagctagaggccatatttggc
cggcccatggttgacggggcagaaggagagcctcacagcatctcaccacggccgagaccc
cctggacgccccatcagtggccacggaacggacagccggccggccatggccatcttcgag
ctgctggactacattgtgaatgagccgcctcccaagctgcccagcggtgtcttcacccag
gacttccaggagtttgtaaataaatgcctcattaagaacccagcggagcgagccgacctg
aagacgctcacgcctggggaggcctgctcttcaggcacctccacgacacgagaccgcgag
ggtcacacctgctggttctcggtctctggtgccgagcgtccaaacacgagcgtctctcag
ttaccgcaacgtggtctttccaaaccacaccttcatcaagcggtccgaggtacaagaagt
ggacttcgccggctggttgtgtaa

DBGET integrated database retrieval system