KEGG   Felis catus (domestic cat): 101081660Help
Entry
101081660         CDS       T02385                                 

Gene name
GSK3B
Definition
(RefSeq) glycogen synthase kinase-3 beta isoform X2
  KO
K03083  glycogen synthase kinase 3 beta [EC:2.7.11.26]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca04012  ErbB signaling pathway
fca04062  Chemokine signaling pathway
fca04110  Cell cycle
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04310  Wnt signaling pathway
fca04340  Hedgehog signaling pathway
fca04360  Axon guidance
fca04390  Hippo signaling pathway
fca04510  Focal adhesion
fca04550  Signaling pathways regulating pluripotency of stem cells
fca04657  IL-17 signaling pathway
fca04660  T cell receptor signaling pathway
fca04662  B cell receptor signaling pathway
fca04722  Neurotrophin signaling pathway
fca04728  Dopaminergic synapse
fca04910  Insulin signaling pathway
fca04916  Melanogenesis
fca04917  Prolactin signaling pathway
fca04919  Thyroid hormone signaling pathway
fca04931  Insulin resistance
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca04934  Cushing syndrome
fca05010  Alzheimer disease
fca05160  Hepatitis C
fca05162  Measles
fca05163  Human cytomegalovirus infection
fca05165  Human papillomavirus infection
fca05167  Kaposi sarcoma-associated herpesvirus infection
fca05200  Pathways in cancer
fca05210  Colorectal cancer
fca05213  Endometrial cancer
fca05215  Prostate cancer
fca05217  Basal cell carcinoma
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Module
fca_M00677  Wnt signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    101081660 (GSK3B)
   04310 Wnt signaling pathway
    101081660 (GSK3B)
   04340 Hedgehog signaling pathway
    101081660 (GSK3B)
   04390 Hippo signaling pathway
    101081660 (GSK3B)
   04151 PI3K-Akt signaling pathway
    101081660 (GSK3B)
   04150 mTOR signaling pathway
    101081660 (GSK3B)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    101081660 (GSK3B)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101081660 (GSK3B)
   04550 Signaling pathways regulating pluripotency of stem cells
    101081660 (GSK3B)
 09150 Organismal Systems
  09151 Immune system
   04660 T cell receptor signaling pathway
    101081660 (GSK3B)
   04657 IL-17 signaling pathway
    101081660 (GSK3B)
   04662 B cell receptor signaling pathway
    101081660 (GSK3B)
   04062 Chemokine signaling pathway
    101081660 (GSK3B)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101081660 (GSK3B)
   04917 Prolactin signaling pathway
    101081660 (GSK3B)
   04919 Thyroid hormone signaling pathway
    101081660 (GSK3B)
   04916 Melanogenesis
    101081660 (GSK3B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101081660 (GSK3B)
   04722 Neurotrophin signaling pathway
    101081660 (GSK3B)
  09158 Development
   04360 Axon guidance
    101081660 (GSK3B)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101081660 (GSK3B)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101081660 (GSK3B)
   05225 Hepatocellular carcinoma
    101081660 (GSK3B)
   05226 Gastric cancer
    101081660 (GSK3B)
   05217 Basal cell carcinoma
    101081660 (GSK3B)
   05215 Prostate cancer
    101081660 (GSK3B)
   05213 Endometrial cancer
    101081660 (GSK3B)
   05224 Breast cancer
    101081660 (GSK3B)
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081660 (GSK3B)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101081660 (GSK3B)
   04931 Insulin resistance
    101081660 (GSK3B)
   04934 Cushing syndrome
    101081660 (GSK3B)
  09172 Infectious disease: viral
   05162 Measles
    101081660 (GSK3B)
   05160 Hepatitis C
    101081660 (GSK3B)
   05163 Human cytomegalovirus infection
    101081660 (GSK3B)
   05167 Kaposi sarcoma-associated herpesvirus infection
    101081660 (GSK3B)
   05165 Human papillomavirus infection
    101081660 (GSK3B)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101081660 (GSK3B)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101081660 (GSK3B)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:fca03036]
    101081660 (GSK3B)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.26  tau-protein kinase
     101081660 (GSK3B)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CMGC group
  GSK family [OT]
   101081660 (GSK3B)
Chromosome and associated proteins [BR:fca03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101081660 (GSK3B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like APH Kdo ABC1
Motif
Other DBs
NCBI-GeneID: 101081660
NCBI-ProteinID: XP_003991723
Ensembl: ENSFCAG00000027379
UniProt: A0A2I2U7S7
Position
C2
AA seq 420 aa AA seqDB search
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTDTK
VIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFYSSG
EKKDEVYLNLVLDYVPETVYRVARHYSRAKQTLPVIYVKLYMYQLFRSLAYIHSFGICHR
DIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYTSSIDV
WSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQIKAHP
WTKVFRPRTPPEAIALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDTPALF
NFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANAGDRGQTNSAASASASNST
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgtcagggcggcccagaaccacctcctttgcggagagctgcaagccagtgcagcagcct
tcagcttttggcagcatgaaagttagcagagacaaagatggcagcaaggtaaccacagtg
gtggcaactcctgggcagggtcccgataggccacaagaagtcagctatacagacactaaa
gtgattggaaatgggtcatttggtgtggtatatcaagccaaactttgtgattcaggagaa
ctggttgccatcaagaaagtattgcaagacaagagatttaagaaccgagagctccaaatc
atgagaaagctagatcactgtaacatagtccgattgcgttatttcttctactcaagtggt
gagaagaaagatgaagtctatcttaatctggtgctggactatgttccggaaacagtatac
agagttgccagacactatagtcgagccaaacagacgctccctgtgatctatgtcaagttg
tatatgtatcagctgttccgaagtttagcctatatccattcctttggaatatgccatcgg
gatattaaaccacagaacctcttgttggatcctgatacagctgtcttaaaactctgtgac
tttggaagtgcaaagcagctggtccgaggagaacccaatgtttcgtatatctgttctcgg
tactatagggcaccagagttgatctttggagccactgattatacctctagtatagacgta
tggtctgcaggttgtgtgttggctgagctgttgctaggacaaccaatatttccaggggac
agtggtgtggatcaattggtggaaataatcaaggtcctggggacaccaacaagggagcaa
attagagaaatgaacccaaactacacagaattcaaattccctcaaattaaggcacatcct
tggactaaggtcttccgaccccggactccaccggaggcaattgcactgtgtagccgtctg
ctggagtatacaccaactgcccgattgacaccactggaagcttgtgcacattcatttttt
gatgaactaagggacccaaatgtcaaactaccaaatgggcgagacacacctgcactcttc
aacttcaccactcaagaactgtcaagtaatccacctctagctaccattcttattcctcct
catgctcggattcaagcagctgcttcaacccctacaaatgccacagcagcctcagatgct
aatgctggagaccgtggacagaccaacagcgctgcttctgcatcagcttccaactccacc
tga

DBGET integrated database retrieval system