KEGG   Felis catus (domestic cat): 101081693Help
Entry
101081693         CDS       T02385                                 

Gene name
PSEN2
Definition
(RefSeq) presenilin-2 isoform X1
  KO
K04522  presenilin 2 [EC:3.4.23.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca04722  Neurotrophin signaling pathway
fca05010  Alzheimer disease
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101081693 (PSEN2)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101081693 (PSEN2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081693 (PSEN2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101081693 (PSEN2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     101081693 (PSEN2)
Peptidases [BR:fca01002]
 Aspartic Peptidases
  Family A22: presenilin family
   101081693 (PSEN2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Presenilin
Motif
Other DBs
NCBI-GeneID: 101081693
NCBI-ProteinID: XP_019677021
Ensembl: ENSFCAG00000008781
UniProt: A0A337S8T8
Position
F1
AA seq 448 aa AA seqDB search
MLTFMASDSEEEVCDERASLMSAESPPPRCCQEDRQGLEDGEGADQWRGQDSEDDFDEDP
DHYVCGGVPGQPSGLEEELTLKYGAKHVIMLFVPVTLCMIVVVATIKSVRFYTEKNGQLI
YTPFTEDTPSVGQRLLNSVLNTLIMISVIVAMTIFLVVLYKYRCYKFIHGWLIMSSLMLL
FLFTYIYLGEVLKTYNVAMDYPTLFLTVWNFGAVGMVCIHWKGPLVLQQAYLIMISALMA
LVFIKYLPEWSAWVILGAISVYDLVAVLCPKGPLRMLVETAQERNEPIFPALIYSSAMVW
TVGMAKLDPSSQGALQLPYDPEMEEDSYDSFGEPSYPEVFEPPLPGYPGDDLEEEEERGV
KLGLGDFIFYSVLVGKAAATGSGDWNTTLACFVAILIGLCLTLLLLAVFKKALPALPISI
TFGLIFYFSTDNLVRPFMDTLASHQLYI
NT seq 1347 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgttcatggcctctgacagcgaggaggaagtgtgtgatgagagggcgtccctg
atgtcggccgagagccccccgccacgctgctgccaggaggacaggcagggcttggaggat
ggagagggtgccgaccagtggagaggccaggatagcgaggacgactttgatgaggaccct
gaccactacgtctgcgggggggtccccgggcagccgtcaggcctggaggaggagctgacc
ctgaaatacggggcgaagcacgtgatcatgctgttcgtgccggtgacgctgtgcatgatc
gtggtggtggccaccatcaagtccgtgcgcttctacacggagaagaacggacagctcatc
tacacaccattcaccgaggacacgccctccgtgggccagcgcctcctcaactccgtgctc
aacaccctcatcatgatcagtgtcattgtggccatgaccatcttcttggtcgtgctctac
aaataccgctgctacaagtttatacacggctggttgatcatgtcctcgctgatgttgctt
ttcctcttcacctacatctacctcggggaggtgctcaagacctacaacgtggccatggac
taccccacgctgttcctgacggtctggaacttcggggcggtgggcatggtgtgtatccac
tggaagggccccctggtcctgcagcaggcctacctcatcatgatcagcgccctcatggcc
ctggtgttcatcaagtaccttccggagtggtccgcgtgggtcatcctgggtgccatctct
gtgtacgatctcgtggctgtgctgtgccccaaagggccactgagaatgctggtggaaacg
gcccaggagagaaacgagcccatattccctgccctgatatactcctccgccatggtgtgg
acggtgggcatggccaagctggacccctcctctcagggagcccttcagctgccctacgac
ccagagatggaggaagactcctatgacagttttggggagccctcgtaccccgaagtcttt
gagcccccgctgcctggttaccccggggacgacctggaggaagaggaggaaaggggcgtg
aagctcggcctgggggacttcatcttctacagcgtgctggtgggcaaggcggcggccacg
ggcagcggcgactggaacacgacgctggcgtgctttgtggccatcctcattggtctgtgt
ctgaccctcctgctgctggccgtgttcaagaaggcgctgcccgccctccccatctccatc
accttcggcctcatcttttacttctctacggacaacctagtgcgccctttcatggacacc
ttggcctcgcatcagctctacatctga

KEGG   Felis catus (domestic cat): 101087239Help
Entry
101087239         CDS       T02385                                 

Gene name
PSEN1
Definition
(RefSeq) presenilin-1 isoform X1
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04310  Wnt signaling pathway
fca04330  Notch signaling pathway
fca04722  Neurotrophin signaling pathway
fca05010  Alzheimer disease
fca05165  Human papillomavirus infection
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101087239 (PSEN1)
   04330 Notch signaling pathway
    101087239 (PSEN1)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101087239 (PSEN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101087239 (PSEN1)
  09172 Infectious disease: viral
   05165 Human papillomavirus infection
    101087239 (PSEN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101087239 (PSEN1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     101087239 (PSEN1)
Peptidases [BR:fca01002]
 Aspartic Peptidases
  Family A22: presenilin family
   101087239 (PSEN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Presenilin
Motif
Other DBs
NCBI-GeneID: 101087239
NCBI-ProteinID: XP_003987854
Ensembl: ENSFCAG00000028093
UniProt: M3WQU7
Position
B3
AA seq 467 aa AA seqDB search
MTELPAPLSYFQNAQMSEDNHLSNTVRSQNDSRERLEHSSERRRRGNPELSNGRPQGNSR
QVVEQDEEEDEELTLKYGAKHVIMLFVPVTLCMVVVVATIKSVSFYTRKDGQLIYTPFTE
DTETVGQRALHSILNAAIMISVIVVMTILLVVLYKYRCYKVIHAWLIISSLLLLFFFSFI
YLGEVFKTYNVAMDYITVALLIWNFGVVGMIAIHWKGPLRLQQAYLIMISALMALVFIKY
LPEWTAWLILAVISVYDLVAVLCPKGPLRMLVETAQERNETLFPALIYSSTMVWLVNMAE
GDPEAQRKVSKNSNCNAQSTEGESQDPVTESDDGGFSEEWEAQRDNRLGPHHSTTESRAA
VQELSSSILASEDPEERGVKLGLGDFIFYSVLVGKASATASGDWNTTIACFVAILIGLCL
TLLLLAIFKKALPALPISITFGLVFYFATDYLVQPFMDQLAFHQFYI
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
atgacagagttacctgcacccttgtcttacttccagaatgcacagatgtccgaggacaac
cacctgagcaatactgtacgtagccagaatgacagtagagaacggcttgagcatagcagt
gaaaggcggaggcgtggcaaccctgagctatctaatggacgaccccagggtaactcacgg
caggtggtggaacaagatgaagaagaagatgaagagctgacgttgaaatatggcgccaaa
catgtgatcatgctctttgtcccggtgactctctgtatggtggtggtcgtggctaccatc
aaatcagtcagcttctatacccggaaggatggacagctaatctataccccattcacagaa
gacaccgagaccgtggggcagagagccctacactcaattctgaatgctgctatcatgatc
agcgtcattgttgtcatgactattctcctggtggttctgtataaatacaggtgctataag
gtcatccatgcctggcttattatttcatctctgttgttgctgttctttttctcattcatt
tacttgggggaagtgtttaaaacctacaatgttgccatggactacattactgttgcactc
ctgatctggaattttggtgtggtgggaatgattgccattcactggaaagggccgctgcga
ctccagcaggcatatctcattatgatcagtgccctcatggccttggtatttatcaagtac
ctcccagagtggacagcatggctcatcttggctgtgatttcagtatatgatttagtggct
gttttgtgtccaaaaggcccacttcgtatgctggttgaaacagctcaggaaagaaatgaa
actctctttccagctctcatttactcctcaacaatggtgtggttggtgaatatggcagaa
ggagacccagaagcccaaaggaaggtatccaaaaactccaattgtaatgcacaaagcaca
gaaggggagtcccaagaccctgtgacagagagcgatgatggtggcttcagtgaagagtgg
gaagcccagagggacaaccgcctagggcctcatcactccacgactgagtcacgagctgct
gtgcaggaactttccagcagcatcctagccagtgaggacccagaagaaaggggagtaaaa
cttggattaggagacttcattttctacagtgttctggttggtaaagcttctgcaacagcc
agtggagactggaacacaaccatagcctgttttgtagccatattaattggtctgtgcctt
acattattactcctcgccattttcaagaaagctctgccagctcttccgatctctatcacc
tttgggcttgttttctactttgccacagattatcttgtacagccctttatggaccagtta
gcattccatcaattttatatatag

DBGET integrated database retrieval system