KEGG   Felis catus (domestic cat): 101081781Help
Entry
101081781         CDS       T02385                                 

Gene name
PBX1
Definition
(RefSeq) pre-B-cell leukemia transcription factor 1 isoform X1
  KO
K09355  pre-B-cell leukemia transcription factor 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
fca05202  Transcriptional misregulation in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101081781 (PBX1)
 09160 Human Diseases
  09161 Cancer: overview
   05202 Transcriptional misregulation in cancer
    101081781 (PBX1)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101081781 (PBX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101081781 (PBX1)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Helix-turn-helix
   Homeo domain only, PBC
    101081781 (PBX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PBC Homeodomain Homeobox_KN YdaS_antitoxin HTH_3 Sec15
Motif
Other DBs
NCBI-GeneID: 101081781
NCBI-ProteinID: XP_006943050
Ensembl: ENSFCAG00000005533
Position
F1
AA seq 430 aa AA seqDB search
MDEQPRLMHSHAGVGMAGHPGLSQHLQDGAGGTEGEGGRKQDIGDILQQIMTITDQSLDE
AQARKHALNCHRMKPALFNVLCEIKEKTVLSIRGAQEEEPTDPQLMRLDNMLLAEGVAGP
EKGGGSAAAAAAAAASGGAGSDNSVEHSDYRAKLSQIRQIYHTELEKYEQACNEFTTHVM
NLLREQSRTRPISPKEIERMVSIIHRKFSSIQMQLKQSTCEAVMILRSRFLDARRKRRNF
NKQATEILNEYFYSHLSNPYPSEEAKEELAKKCGITVSQVSNWFGNKRIRYKKNIGKFQE
EANIYAAKTAVTATNVSAHGSQANSPSTPNSAGSSSSFNMSNSGDLFMGVQSLNGDSYQG
AQVGANVQSQVDTLRHVISQTGGYSDGLAASQMYSPQGISANGGWQDATTPSSVTSPTEG
PGSVHSDTSN
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggacgagcagcccaggctgatgcattcccatgctggggtcgggatggccggacacccc
ggcctgtcccagcacttgcaggatggggccggagggaccgagggggagggcgggaggaag
caggacattggagacattttacagcaaattatgaccatcacagaccagagtttggatgag
gcgcaggccagaaaacatgctttaaactgccacagaatgaagcctgccttgtttaatgtg
ttgtgtgaaatcaaagaaaaaacagtcttgagtatccggggagcccaggaggaggagccg
acagacccccagctgatgcgactggacaacatgctgctggccgagggggtggcgggcccc
gagaagggtggtggctcggcggcagccgcagccgcagcggcggcttcgggaggcgcgggc
tcagacaactccgtggagcactccgattacagagccaagctgtcccagatcagacagatc
taccacacggagctggagaagtacgagcaggcgtgcaacgaatttaccacccacgtgatg
aacctgctgcgggagcagagccggaccaggcccatctcccccaaggagatcgagcgtatg
gtcagcatcatccaccgcaaattcagctccatccagatgcaacttaagcagagcacatgc
gaggccgtcatgatcctgcgctcccggtttctggacgcgcggcggaagagacggaatttc
aacaagcaagcaacggaaatcctgaatgaatatttctattcccatctcagcaacccttac
cccagtgaggaagccaaagaggagttagccaagaagtgtggcatcacagtgtcccaggta
tcaaactggtttggaaataagcgaatccggtacaagaagaacataggtaaatttcaagag
gaagccaatatttatgctgccaaaacggctgtcactgctaccaatgtgtcagcccatgga
agccaagctaactcaccctcgactcctaactcagctggttcttccagttcttttaacatg
tcaaactctggagatttgttcatgggcgtgcagtcactcaatggggactcttaccaaggg
gcccaggttggagccaacgtgcagtcacaggtggatacccttcgccatgttatcagccag
acaggaggatacagtgacggactcgcagccagtcagatgtacagtccgcagggcatcagt
gctaatggaggttggcaggatgccactaccccttcatcagtgacctcccctacagaaggc
cctggcagtgttcactctgatacctccaactga

DBGET integrated database retrieval system