KEGG   Felis catus (domestic cat): 101081808Help
Entry
101081808         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 5A, mitochondrial
  KO
K02264  cytochrome c oxidase subunit 5a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101081808
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101081808
  09159 Environmental adaptation
   04714 Thermogenesis
    101081808
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101081808
   05012 Parkinson disease
    101081808
   05016 Huntington disease
    101081808
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101081808
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX5A
Motif
Other DBs
NCBI-GeneID: 101081808
NCBI-ProteinID: XP_003986990
Ensembl: ENSFCAG00000010587
UniProt: M3WDJ6
Position
B3
AA seq 152 aa AA seqDB search
MLGAALRRCAVAAAAAPRASPRGLLYPAPGPGSAAAVQSVRCYSHGSHETDEEFDARWVT
YFNKPDIDAWELRKGMNTLVGYDLVPEPKIIDAALRACRRLNDFASAVRILEVVKDKAGP
HKEIYPYVIQELRPTLNELGISTPEELGLDKV
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atgctcggcgccgctctccgccgttgcgctgtagcagcagccgcagccccccgtgccagc
ccccgaggcctcctgtacccagctccgggtcccggctccgccgccgctgtccagtcagtt
cgctgctactcccatgggtcacatgaaacagatgaggagtttgatgctcgctgggtgaca
tacttcaacaagccagatattgacgcctgggaattgcgtaaaggaatgaacacgcttgtt
ggctatgatctggttccagaacctaaaatcattgatgctgctttgcgggcatgcagacgg
ttaaatgattttgctagtgcagttcgcatcctagaggttgttaaggacaaagcaggacct
cataaggaaatctacccctatgtcatccaggaacttagaccaactttaaatgaactggga
atctccactccagaggaactgggccttgacaaagtgtaa

KEGG   Felis catus (domestic cat): 101083819Help
Entry
101083819         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 7A1, mitochondrial isoform X2
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101083819
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101083819
  09159 Environmental adaptation
   04714 Thermogenesis
    101083819
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101083819
   05012 Parkinson disease
    101083819
   05016 Huntington disease
    101083819
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101083819
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7a
Motif
Other DBs
NCBI-GeneID: 101083819
NCBI-ProteinID: XP_003997968
Ensembl: ENSFCAG00000014155
UniProt: M3WK61
Position
E2
AA seq 80 aa AA seqDB search
MRALRVSQALVRSFSSTARNRFENRVAEKQKVFQADNDLPVHLKGGATDNILYRLTMGLC
LGGTVYSLYCLGWASFPHNK
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgagggccctgcgggtctcccaagcactggttcgctctttcagctcaaccgcccggaac
cgctttgagaaccgagtggctgagaaacagaaagtcttccaggcggacaatgacctccca
gtacacttgaagggcggggcaacagacaacatcctgtatcgactgaccatgggcctgtgt
ctagggggcaccgtctatagcctgtactgccttggctgggcctccttccctcacaacaag
tga

KEGG   Felis catus (domestic cat): 101085531Help
Entry
101085531         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 7B, mitochondrial
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101085531
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101085531
  09159 Environmental adaptation
   04714 Thermogenesis
    101085531
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101085531
   05012 Parkinson disease
    101085531
   05016 Huntington disease
    101085531
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101085531
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7B
Motif
Other DBs
NCBI-GeneID: 101085531
NCBI-ProteinID: XP_004000711
Ensembl: ENSFCAG00000023091
UniProt: A0A2I2UIV7
Position
X
AA seq 80 aa AA seqDB search
MFPMARNAFSRLRVQSIQQTMARQSHQKRTPDFHDKYGNAVLASGATFCVAVWAYTATQI
GIEWNLSPVGRVTPKEWRDQ
NT seq 243 nt NT seq  +upstreamnt  +downstreamnt
atgtttcctatggccagaaacgctttcagtcgtctccgagttcaaagcattcagcaaaca
atggcaaggcagagccaccagaaacggacacctgatttccatgacaaatacggtaatgct
gtattagctagtggagccactttctgtgttgctgtatgggcttatacagcaacacaaatt
ggaatagaatggaacctgtcccctgttggcagagtcaccccaaaggaatggagagatcag
tag

KEGG   Felis catus (domestic cat): 101089914Help
Entry
101089914         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 4 isoform 1, mitochondrial
  KO
K02263  cytochrome c oxidase subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101089914
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101089914
  09159 Environmental adaptation
   04714 Thermogenesis
    101089914
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101089914
   05012 Parkinson disease
    101089914
   05016 Huntington disease
    101089914
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101089914
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX4
Motif
Other DBs
NCBI-GeneID: 101089914
NCBI-ProteinID: XP_023101380
Ensembl: ENSFCAG00000007612
Position
E2
AA seq 169 aa AA seqDB search
MLATRVFSLIGKRAISTSVCVRAHGSVVKSEDYALPSYVDRRDYPLPDVAHVKNLSASQK
ALKEKEKAPWSSLSIDEKVELYRMKFNESFAEMNRSTNEWKTVVGAAMFFIGFTALLLIW
EKHYVYGPIPHTFEEEWVAKQTKRMLDMKVSPIQGFSAKWDYDKNEWKK
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgttggctaccagagtgtttagcctaattggcaagcgagcaatttccacctcagtgtgt
gtacgagcgcatggaagcgtcgtgaagagtgaagattacgctctcccgagttatgtggac
cggcgtgactaccccctgcccgacgtggcccacgtcaagaacctctctgccagccagaag
gccttgaaagagaaagagaaggccccctggagcagcctctccatcgatgaaaaagttgaa
ttgtaccgcatgaagttcaacgagagcttcgcggaaatgaacaggagcacgaacgagtgg
aagacggttgtgggcgctgccatgttcttcatcggcttcaccgctctcctcctgatctgg
gagaagcactatgtgtatggccccatcccgcacaccttcgaggaggagtgggtggctaag
cagaccaagaggatgctggacatgaaggtcagcccgatccagggcttctcagccaagtgg
gactacgacaagaacgagtggaagaagtag

KEGG   Felis catus (domestic cat): 101090761Help
Entry
101090761         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 5B, mitochondrial
  KO
K02265  cytochrome c oxidase subunit 5b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101090761
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101090761
  09159 Environmental adaptation
   04714 Thermogenesis
    101090761
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101090761
   05012 Parkinson disease
    101090761
   05016 Huntington disease
    101090761
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101090761
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX5B DUF35_N zinc_ribbon_5 zf-CHCC zf-RING_4
Motif
Other DBs
NCBI-GeneID: 101090761
NCBI-ProteinID: XP_003983971
Ensembl: ENSFCAG00000001704
UniProt: M3VX46
Position
A3
AA seq 129 aa AA seqDB search
MASRLLRGVGSLAAQALRVRGPNGVAAVRSMASGGGVPTDDEQATGLEREVMMAARKGLD
PYNMLAPKAASGTKEDPNLVPSITNKRIVGCICEEDNSAVIWFWLHKGEAQRCPSCGTHY
KLVPHQLAH
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
atggcttcaaggttacttcgtggagttggatcgctggccgcacaggccctcagggtccgc
ggtcccaatggagtcgccgcagtgcgctccatggcatctggaggcggtgttcctactgat
gatgagcaggcaactgggctggagagggaggtcatgatggctgctcggaagggactggac
ccatacaatatgctagccccaaaagcagcttcaggcaccaaggaagaccctaatttagtg
ccatctatcactaacaagcgaattgtgggctgcatctgtgaagaggacaatagtgctgtc
atctggttctggcttcacaaaggcgaggcccagcgatgccctagctgtggaacccattac
aagctggtgccccatcagttggcccactga

KEGG   Felis catus (domestic cat): 101092350Help
Entry
101092350         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 7A-related protein, mitochondrial
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101092350
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101092350
  09159 Environmental adaptation
   04714 Thermogenesis
    101092350
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101092350
   05012 Parkinson disease
    101092350
   05016 Huntington disease
    101092350
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101092350
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7a
Motif
Other DBs
NCBI-GeneID: 101092350
NCBI-ProteinID: XP_003984341
Ensembl: ENSFCAG00000022642
UniProt: A0A2I2UF99
Position
A3
AA seq 114 aa AA seqDB search
MYYKFSGFTQKLTGTWASDAYSPQGLRPVVSTEAPPIIFATPTKLSSDFTAYDYAGKNKV
PELQKLFQKSDGVPIHLKRGLPDQMLYRTTMALTVGGTIYCLIALYMASQPKNK
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtattacaagtttagtggcttcacgcagaagttgactggaacatgggcttccgacgct
tacagccctcagggattaaggcctgtggtttccacagaagcaccgcctatcatatttgcc
acacccaccaaactgagttctgattttactgcatatgattatgctgggaaaaacaaagtt
cctgagctgcagaagcttttccagaagtccgacggtgtgcccatccatctaaaacgaggc
ctgcctgaccaaatgttgtaccggaccaccatggcgctgacagtgggagggaccatctac
tgcctgattgctctctacatggcttcccagcccaaaaacaaatga

KEGG   Felis catus (domestic cat): 101093608Help
Entry
101093608         CDS       T02385                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: uncharacterized protein LOC101093608
  KO
K02270  cytochrome c oxidase subunit 7a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101093608
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101093608
  09159 Environmental adaptation
   04714 Thermogenesis
    101093608
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101093608
   05012 Parkinson disease
    101093608
   05016 Huntington disease
    101093608
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101093608
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7a
Motif
Other DBs
NCBI-GeneID: 101093608
NCBI-ProteinID: XP_023110497
Ensembl: ENSFCAG00000009787
Position
B2
AA seq 271 aa AA seqDB search
MNVKVVLRNSEIESLRFQETKNTTEMENHQKSSGWRTMYETVHTCSFSPDTEKRANSFHN
FRTLVAFLAWGVVQHPKVQDDTRRSSLQHILSTRNNNALTKFLLRKKTDCIREREQGTET
AGRLERPQSYGRSRLSFALYGLEAQAPPPPEVLSSLTHAQGQKAVPVPVLPFSFLVFGCC
SWWVVTAKMLRNLLALRQIAQRTISTASRRQIENKVPEKQKLFQEDNGIPVHLKGGIADA
LLYRATMMLTVGGTAYAIYQLAMASFPKKQD
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atgaatgtaaaggtggtactccgaaattcagagattgagagtttgaggtttcaggagact
aaaaacactactgaaatggaaaaccatcaaaagagtagtggatggaggaccatgtatgaa
actgtacatacatgttcattttccccagacacggagaaacgagcgaacagctttcacaat
ttcaggacgctggtagcgtttcttgcatggggagttgtgcagcatccaaaggtacaagac
gatacccgacgcagctctttacagcatattctcagcacaaggaacaataacgccctcaca
aagtttcttctacggaaaaaaactgattgtatccgtgaacgagagcaaggaacggaaacg
gccggtcggctagagcggccacagtcgtacggccgctctcgcttgtctttcgctctctat
ggtttagaggctcaagcccctcctccgcccgaagtattaagttccctgacgcatgcgcaa
ggccagaaggcagttccggttccggtgttgccgttctcgttcctggtgttcggttgttgc
agttggtgggtagtaaccgccaagatgctgcggaatctgctggctcttcgtcagattgcc
cagaggaccataagcactgcttcacgcaggcagattgaaaataaggttccagagaagcag
aagctatttcaggaggataatggaattccagtgcatctaaagggtggaatagctgatgcc
ctcctgtatagagccactatgatgcttacagttggtggaactgcgtatgccatatatcag
ctagctatggcttcatttcccaagaagcaagactga

KEGG   Felis catus (domestic cat): 101095773Help
Entry
101095773         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6A1, mitochondrial
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101095773
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101095773
  09159 Environmental adaptation
   04714 Thermogenesis
    101095773
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101095773
   05012 Parkinson disease
    101095773
   05016 Huntington disease
    101095773
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101095773
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6A
Motif
Other DBs
NCBI-GeneID: 101095773
NCBI-ProteinID: XP_003994770
Ensembl: ENSFCAG00000031188
UniProt: M3WRN1
Position
D3
AA seq 109 aa AA seqDB search
MAVAAASRFSGLLGRSGAQRGRSMSSGAHGEEGSARMWKALTYFVALPGVGVSMLNVFLK
SHHGEHERPEFVAYPHLRIRSKPFPWGDGNHTLFHNSHVNPLPTGYEDE
NT seq 330 nt NT seq  +upstreamnt  +downstreamnt
atggcggtggcggctgcgtcccggttttcggggctgctaggtcggtccggggcgcagcgg
gggcggtccatgtcgagtggcgcccacggcgaggagggctcagctcgcatgtggaaggcc
ctcacctacttcgtagctcttcctggcgtgggagtgagcatgctgaacgtcttcctgaag
tcgcatcacggagagcacgagagacccgagttcgtcgcctacccccatctccgcatcagg
tccaagccctttccctggggagatggtaatcatactctattccataactctcacgtgaat
ccacttccgaccggctatgaagatgaataa

KEGG   Felis catus (domestic cat): 101096603Help
Entry
101096603         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 8A, mitochondrial
  KO
K02273  cytochrome c oxidase subunit 8
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096603
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096603
  09159 Environmental adaptation
   04714 Thermogenesis
    101096603
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096603
   05012 Parkinson disease
    101096603
   05016 Huntington disease
    101096603
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX8
Motif
Other DBs
NCBI-GeneID: 101096603
NCBI-ProteinID: XP_003993597
Ensembl: ENSFCAG00000014662
UniProt: M3WL37
Position
D1
AA seq 69 aa AA seqDB search
MSVLTPLLLRGLTGLTRRLPVQRAQIHSKPPQEQLGTMEVAIGLTSCFVCFLLPSGWVLS
HLESYKKRE
NT seq 210 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtactgaccccgctgctgctgaggggcctgacaggcctaacccggcggcttccg
gtgcagcgtgctcagatccattccaagcctccgcaggagcagctcgggaccatggaagtc
gccatcgggctcacctcctgcttcgtgtgtttcctcctgccgtcgggctgggtcctgtca
catctggagagctacaagaagcgggagtga

KEGG   Felis catus (domestic cat): 101096643Help
Entry
101096643         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 4 isoform 2, mitochondrial isoform X2
  KO
K02263  cytochrome c oxidase subunit 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096643
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096643
  09159 Environmental adaptation
   04714 Thermogenesis
    101096643
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096643
   05012 Parkinson disease
    101096643
   05016 Huntington disease
    101096643
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096643
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX4
Motif
Other DBs
NCBI-GeneID: 101096643
NCBI-ProteinID: XP_003983688
Ensembl: ENSFCAG00000014664
UniProt: M3WL40
Position
A3
AA seq 171 aa AA seqDB search
MFFRAVWSLVLRKGGPRMRQMHSPGSAAHSKEKMPPYTNYHAQRSYPMPDEPFCTELNAE
QRALKEKEKGSWTQLTHDEKVALYRLQFHETFAEMNRRSNEWKTVMGCVFFFFGFTALMI
WWQRIYVFPKKPVTLTDEWKAQQLQRILDMKGNPVQGLASRWDYEKKEWKK
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atgttcttcagagctgtctggagcttggtgctgaggaaaggaggacccaggatgcggcag
atgcacagcccgggaagcgctgcccacagcaaggagaagatgcccccctacactaactac
catgcccagcgctcctaccccatgcccgatgagcccttctgcacagagctcaacgctgag
cagcgggccctgaaggagaaagagaagggcagctggacccagctgacccacgacgagaag
gtggccttgtaccggctccagttccatgagaccttcgcggagatgaaccgtcgctccaat
gagtggaagacagtgatgggctgcgtcttcttcttttttggattcacagctctgatgatt
tggtggcagcggatctatgtgttccctaagaagcctgtcaccctgacggatgagtggaag
gcccagcagctccagcgcatcctagacatgaagggcaaccccgtgcaagggctggcctcc
cggtgggactatgagaagaaggagtggaagaagtga

KEGG   Felis catus (domestic cat): 101096876Help
Entry
101096876         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6C
  KO
K02268  cytochrome c oxidase subunit 6c
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101096876
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101096876
  09159 Environmental adaptation
   04714 Thermogenesis
    101096876
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101096876
   05012 Parkinson disease
    101096876
   05016 Huntington disease
    101096876
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101096876
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6C
Motif
Other DBs
NCBI-GeneID: 101096876
NCBI-ProteinID: XP_023104305
Position
F2
AA seq 75 aa AA seqDB search
MTSGALAKPQMRGLLAKRLRFHIVGAFAVSLGVAAFYKFAVAEPRKKAYADFYRNYDSMK
DFEEMKKAGIFQSAK
NT seq 228 nt NT seq  +upstreamnt  +downstreamnt
atgacttccggtgctttggcgaaacctcagatgcgaggccttctggccaagcgcctgcga
tttcatattgtcggagcgttcgctgtttccctgggggttgcagctttctataagtttgct
gtggccgaaccaagaaagaaggcgtatgcagatttctacagaaattatgattccatgaaa
gattttgaggagatgaagaaggctggtatctttcagagtgcaaagtga

KEGG   Felis catus (domestic cat): 101097447Help
Entry
101097447         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6B1-like
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101097447
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101097447
  09159 Environmental adaptation
   04714 Thermogenesis
    101097447
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101097447
   05012 Parkinson disease
    101097447
   05016 Huntington disease
    101097447
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101097447
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6B HD-ZIP_N YozE_SAM_like
Motif
Other DBs
NCBI-GeneID: 101097447
NCBI-ProteinID: XP_019675785
Position
E3
AA seq 169 aa AA seqDB search
PAETRCVADSPVRGQTRAKQTEKQQVNHSLWQVLGREQSALGGDTLTRVVSTRRRPLKIE
EEVFAEGHTELRGASGVSLGLSTTAEDIKTKVKNDQTAPFDSRFPSQSQTRNSWQNYLDF
HRCEKAMTAKGGEVSVCEWYRRVYKSLCPMSWVAAWDDRRAEGTFPGKI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
cccgctgagacacgctgtgtggctgacagtcccgtgcggggacagacaagagccaagcag
acagaaaagcagcaagtgaatcacagtctgtggcaggtgctgggacgggaacagagcgcg
ctgggaggggacactttaacaagggtggtttccacgaggagacggccgttgaagattgaa
gaggaggtctttgctgagggtcacactgagctgcgaggtgcttcgggggtgtctttagga
ctcagcaccacggcagaagacatcaagaccaaagtcaagaacgaccagaccgcccctttt
gacagccgcttccccagccagagccagacccggaactcctggcaaaactacctagacttc
caccgctgtgagaaggcgatgactgctaaagggggtgaggtctccgtgtgcgaatggtac
cggcgtgtgtacaagtccctctgccccatgtcctgggtggcagcctgggacgaccgccgg
gcggaaggcacgtttcccgggaagatctga

KEGG   Felis catus (domestic cat): 101098629Help
Entry
101098629         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 7B2, mitochondrial
  KO
K02271  cytochrome c oxidase subunit 7b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101098629
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101098629
  09159 Environmental adaptation
   04714 Thermogenesis
    101098629
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101098629
   05012 Parkinson disease
    101098629
   05016 Huntington disease
    101098629
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101098629
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7B
Motif
Other DBs
NCBI-GeneID: 101098629
NCBI-ProteinID: XP_006931198
UniProt: A0A2I2UWQ6
Position
B1
AA seq 79 aa AA seqDB search
MMFLLTRNALRRFKIRSIQQIRQSHEKHSPDFHDKYGNIVLASGSAFCVVAWVFTATQIG
IEWNLSPVGRVTPEEWNDK
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atgatgtttctcttgaccagaaatgcactaagaaggttcaagattcgaagcattcaacaa
attagacaaagccatgaaaaacactcaccagattttcatgacaaatatggtaatattgtg
ctggccagtggaagtgctttctgtgttgttgcatgggtgtttacagccacacagattgga
atagaatggaacctgtctcctgttggcagagtcaccccagaagagtggaatgataaataa

KEGG   Felis catus (domestic cat): 101100266Help
Entry
101100266         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6B1
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    101100266
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    101100266
  09159 Environmental adaptation
   04714 Thermogenesis
    101100266
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101100266
   05012 Parkinson disease
    101100266
   05016 Huntington disease
    101100266
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101100266
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6B
Motif
Other DBs
NCBI-GeneID: 101100266
NCBI-ProteinID: XP_003997948
Ensembl: ENSFCAG00000006378
UniProt: A0A2I2UCG4
Position
E2
AA seq 86 aa AA seqDB search
MAEDIKTKIKNYQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRV
YKSLCPISWVAAWDDRRAEGTFPGKI
NT seq 261 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagacatcaagaccaaaatcaagaactaccagactgccccttttgacagccgc
ttccccaaccagaaccagaccaggaactgctggcagaactacctggacttccaccgctgt
gagaaggcgatgactgctaaagggggtgatgtctccgtgtgtgaatggtaccggcgtgtg
tacaagtccctctgccccatatcctgggtggcagcctgggacgatcgccgggcggaaggc
acgtttcctgggaagatctga

KEGG   Felis catus (domestic cat): 102899183Help
Entry
102899183         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 7C, mitochondrial
  KO
K02272  cytochrome c oxidase subunit 7c
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    102899183
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    102899183
  09159 Environmental adaptation
   04714 Thermogenesis
    102899183
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102899183
   05012 Parkinson disease
    102899183
   05016 Huntington disease
    102899183
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    102899183
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX7C RhodobacterPufX
Motif
Other DBs
NCBI-GeneID: 102899183
NCBI-ProteinID: XP_011282740
UniProt: A0A2I2UAC5
Position
A1
AA seq 63 aa AA seqDB search
MLGQSIRRFTTSVVRRSHYEEGPGKNLPFSVENKWRLLVMMTMYFGSGFAAPFFIVRHQL
LKK
NT seq 192 nt NT seq  +upstreamnt  +downstreamnt
atgttgggacagagcatccggaggttcacaacctctgtggtccgtagaagccactatgag
gagggcccagggaagaatttgccattttcagtggaaaacaagtggcggttacttgttatg
atgactatgtactttggatctggatttgctgcacctttttttatagtaagacaccagctg
cttaagaaataa

KEGG   Felis catus (domestic cat): 105261211Help
Entry
105261211         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6B2
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105261211
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105261211
  09159 Environmental adaptation
   04714 Thermogenesis
    105261211
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105261211
   05012 Parkinson disease
    105261211
   05016 Huntington disease
    105261211
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105261211
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6B CX9C UCR_hinge
Motif
Other DBs
NCBI-GeneID: 105261211
NCBI-ProteinID: XP_023101770
Ensembl: ENSFCAG00000031208
Position
E2
AA seq 88 aa AA seqDB search
MLDIEFQKSPKGKWTTPPFDPRFPNQNQTRNCYQNFLDYHRCVKRMNRRGKSTQPCEYYF
RVFHSLCPKSWVQRWTEQIQRGTFAGKI
NT seq 267 nt NT seq  +upstreamnt  +downstreamnt
atgttggatattgagttccagaagtcccccaaggggaaatggacaacaccacccttcgac
ccgcgcttccccaaccagaaccagacccgcaactgctaccagaactttctggactaccac
cgctgcgtcaagagaatgaaccgccgtgggaaaagcacgcagccctgcgagtattacttc
cgcgtgttccactcgctgtgccccaagagctgggtgcagcgctggaccgagcagatccag
agagggaccttcgcaggcaaaatctga

KEGG   Felis catus (domestic cat): 105261306Help
Entry
105261306         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6A2, mitochondrial
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    105261306
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    105261306
  09159 Environmental adaptation
   04714 Thermogenesis
    105261306
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    105261306
   05012 Parkinson disease
    105261306
   05016 Huntington disease
    105261306
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    105261306
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6A
Motif
Other DBs
NCBI-GeneID: 105261306
NCBI-ProteinID: XP_011288850
Position
E3
AA seq 96 aa AA seqDB search
MALPLRSLSRGLASTAKGDHGGAGASTWRLLTFVLALPSVALCTLNSWLHAGHRERPKFI
PYHHLRIRTKPYSWGDGNHTLFHNPRVNPLPTGYEQ
NT seq 291 nt NT seq  +upstreamnt  +downstreamnt
atggctctgcctctgaggtccctgagtcggggcttggcaagcacagcaaagggagaccat
ggaggggcaggagccagcacttggcgcctcctgaccttcgtgctggcgctcccgagtgtg
gccctctgcacccttaactcctggctccacgcgggccatcgtgaacgccccaagttcatc
ccataccaccacctccgtatccgcaccaagccctactcctggggagacggcaaccatact
cttttccacaacccccgtgtcaaccctctgcccaccggctatgaacagtga

KEGG   Felis catus (domestic cat): 109496610Help
Entry
109496610         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6B1-like
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    109496610
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    109496610
  09159 Environmental adaptation
   04714 Thermogenesis
    109496610
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    109496610
   05012 Parkinson disease
    109496610
   05016 Huntington disease
    109496610
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    109496610
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6B
Motif
Other DBs
NCBI-GeneID: 109496610
NCBI-ProteinID: XP_019679878
Position
X
AA seq 79 aa AA seqDB search
MAEDIKIKIKRGAWNYQTTPFDSRFPNQNQTRKCWQNSLDLPHCDRAMTAQRDAISAWEW
YLRVFRSLCLASWVSVSLG
NT seq 240 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagacatcaagatcaaaatcaagagaggcgcctggaactaccagactacccct
tttgacagccgcttccccaaccagaaccagaccaggaagtgctggcagaactccctggac
ttgccccactgtgacagggcaatgactgcccaaagggatgctatctctgcatgggagtgg
tacctgcgtgtgttcaggtccctctgcctcgcatcctgggtgtcagtcagcctgggatga

KEGG   Felis catus (domestic cat): 111559153Help
Entry
111559153         CDS       T02385                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6B1-like
  KO
K02267  cytochrome c oxidase subunit 6b
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    111559153
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    111559153
  09159 Environmental adaptation
   04714 Thermogenesis
    111559153
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    111559153
   05012 Parkinson disease
    111559153
   05016 Huntington disease
    111559153
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    111559153
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX6B
Motif
Other DBs
NCBI-GeneID: 111559153
NCBI-ProteinID: XP_023105484
Position
E3
AA seq 169 aa AA seqDB search
PAETRCVADSPVRGQTRAKQTEKQQVNHSLWQVLGREQSALGGDTLTRVVSTRRRPLKIE
EEVFAEGHTELRGASGVSLGLSTTAEDIKTKVKNDQTAPFDSRFPSQSQTGTPGKNYLDF
HRCEKAMTAKGGEVSVCEWYRRVYKSLCPMSWVAAWDDRRAEGTFPGKI
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
cccgctgagacacgctgtgtggctgacagtcccgtgcggggacagacaagagccaagcag
acagaaaagcagcaagtgaatcacagtctgtggcaggtgctgggacgggaacagagcgcg
ctgggaggggacactttaacaagggtggtttccacgaggagacggccgttgaagattgaa
gaggaggtctttgctgagggtcacactgagctgcgaggtgcttcgggggtgtctttagga
ctcagcaccacggcagaagacatcaagaccaaagtcaagaacgaccagaccgcccctttt
gacagccgcttccccagccagagccagaccggaactcctggcaaaaactacctagacttc
caccgctgtgagaaggcgatgactgctaaagggggtgaggtctccgtgtgcgaatggtac
cggcgtgtgtacaagtccctctgccccatgtcctgggtggcagcctgggacgaccgccgg
gcggaaggcacgtttcccgggaagatctga

KEGG   Felis catus (domestic cat): 807933Help
Entry
807933            CDS       T02385                                 

Gene name
COX3
Definition
(RefSeq) cytochrome c oxidase subunit III
  KO
K02262  cytochrome c oxidase subunit 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807933 (COX3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    807933 (COX3)
  09159 Environmental adaptation
   04714 Thermogenesis
    807933 (COX3)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    807933 (COX3)
   05012 Parkinson disease
    807933 (COX3)
   05016 Huntington disease
    807933 (COX3)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    807933 (COX3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    807933 (COX3)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    807933 (COX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX3
Motif
Other DBs
NCBI-GeneID: 807933
NCBI-ProteinID: NP_008257
UniProt: P48892
Position
MT
AA seq 261 aa AA seqDB search
MTHQTHAYHMVNPSPWPLTGALSALLMTSGLAMWFHYNLTLLLTLGMTTNLLTMYQWWRD
IIRESTFQGHHTPIVQKGLRYGMILFIISEVFFFAGFFWAFYHSSLAPTPELGGCWPPTG
IIPLNPLEVPLLNTSVLLASGVSITWAHHSLMEGNRKHMLQALFITISLGVYFTLLQASE
YYETSFTISDGVYGSTFFMATGFHGLHVIIGSTFLIVCFLRQLKYHFTSNHHFGFEAAAW
YWHFVDVVWLFLYVSIYWWGS
NT seq 784 nt NT seq  +upstreamnt  +downstreamnt
atgacccaccaaacccatgcataccacatagtcaaccctagcccatggccacttacagga
gccctttcagccctcttaataacctcaggcctggctatatgattccactacaacttaaca
ctgctgttaacccttggaataactaccaacttactaactatatatcaatgatgacgagac
attatccgagaaagcacattccaaggccatcatacacctatcgttcaaaaaggccttcga
tacggaataatcctctttatcatctcagaagtattctttttcgcaggcttcttctgggcc
ttctaccactcaagcctagccccaacccccgagctaggaggatgctgaccaccaacaggc
attattcccctgaaccccctggaagttccactacttaatacctccgtgcttctagcctcc
ggagtatcaatcacctgagctcaccacagtttgatggagggaaatcgaaaacacatgctt
caagcactatttattacaatctctttaggggtctactttacactcctccaagcctccgaa
tactatgaaacatcattcacgatctcggacggagtatacggatctaccttcttcatggcc
acaggattccatgggctacatgtaattattggctctactttcctaattgtatgcttctta
cgccaattaaaatatcactttacatcaaatcaccacttcggatttgaagccgccgcctga
tattgacacttcgtagacgtagtttgactattcctatacgtttctatttattgatgagga
tcct

KEGG   Felis catus (domestic cat): 807934Help
Entry
807934            CDS       T02385                                 

Gene name
COX1
Definition
(RefSeq) cytochrome c oxidase subunit I
  KO
K02256  cytochrome c oxidase subunit 1 [EC:1.9.3.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807934 (COX1)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    807934 (COX1)
  09159 Environmental adaptation
   04714 Thermogenesis
    807934 (COX1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    807934 (COX1)
   05012 Parkinson disease
    807934 (COX1)
   05016 Huntington disease
    807934 (COX1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    807934 (COX1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    807934 (COX1)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.9  Acting on a heme group of donors
   1.9.3  With oxygen as acceptor
    1.9.3.1  cytochrome-c oxidase
     807934 (COX1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    807934 (COX1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX1
Motif
Other DBs
NCBI-GeneID: 807934
NCBI-ProteinID: NP_008253
UniProt: P48888
Position
MT
AA seq 514 aa AA seqDB search
MFMNRWLFSTNHKDIGTLYLLFGAWAGMVGTALSLLIRAELGQPGTLLGDDQIYNVIVTA
HAFVMIFFMVMPIMIGGFGNWLVPLMIGAPDMAFPRMNNMSFWLLPPSFLLLLASSMVEA
GAGTGWTVYPPLAGNLAHAGASVDLTIFSLHLAGVSSILGAINFITTIINMKPPAMSQYQ
TPLFVWSVLITAVLLLLSLPVLAAGITMLLTDRNLNTTFFDPAGGGDPILYQHLFWFFGH
PEVYILILPGFGMISHIVTYYSGKKEPFGYMGMVWAMMSIGFLGFIVWAHHMFTVGMDVD
TRAYFTSATMIIAIPTGVKVFSWLATLHGGNIKWSPAMLWALGFIFLFTVGGLTGIVLAN
SSLDIVLHDTYYVVAHFHYVLSMGAVFAIMGGFVHWFPLFSGYTLDNTWAKIHFTIMFVG
VNMTFFPQHFLGLSGMPRRYSDYPDAYTTWNTISSMGSFISLTAVMLMVFMVWEAFASKR
EVAMVELTTTNLEWLHGCPPPYHTFEEPTYVLLK
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atgttcataaaccggtgactattttcaactaatcacaaagatattggtactctttacctt
ttattcggtgcctgagctggcatggtggggactgctcttagtcttctaatccgggccgaa
ctgggccaacctggtacactactaggagatgatcagatttacaatgtaatcgtcactgcc
catgcttttgtaatgatcttttttatggtgatgcctattataattggagggttcggaaac
tgattggtcccattaataattggagctcctgacatagcatttccccgaataaacaacatg
agcttctgactcctccctccatcctttctactcttactcgcctcatctatggtagaagcc
ggagcaggaactgggtgaacagtatacccacccctagccggcaacctggctcatgcagga
gcatccgtagacctaactattttttcactacacctggcaggtgtctcctcaatcttgggt
gctattaatttcattactactattattaatataaaacctcctgccatgtcccaatatcaa
acacctctatttgtctgatcagtcttaatcactgctgtcttactacttctatcacttcca
gtcttagcagcgggaatcactatattattaacagatcgaaacctaaacaccacattcttt
gaccccgctgggggaggagatcctatcttataccaacacttattctgattctttggccat
ccagaagtttacattttaatcctacccggttttgggataatctcacatattgttacctat
tattcaggtaaaaaagaaccctttggctacatgggaatagtttgagccatgatatcaatc
ggcttcctgggctttatcgtatgagcccatcacatgtttactgtaggaatggatgtagac
acacgagcatactttacatcagccactataattattgccattcctaccggggtgaaagta
tttagttgactggctactcttcatggaggtaatattaaatggtcccctgctatattatga
gccttaggctttattttcctatttaccgtaggaggcctaacgggaattgtactagcaaac
tcttcattagacattgttcttcacgacacatattacgtagtggcccactttcactatgtc
ttgtcaataggagcagtattcgctatcataggaggcttcgtccattgattccccctattc
tcaggatatacccttgacaacacttgagcaaagattcactttacgattatgtttgtagga
gtcaatataacgttcttccctcagcacttcctaggcctgtccggaatgccacgacgttat
tctgactatccagatgcatatacaacttgaaatacgatttcctcaatgggctctttcatc
tcattaacagcagtcatgttaatagttttcatagtgtgagaagctttcgcatccaagcga
gaagtggccatagtagaactaaccacaactaatcttgaatgattgcatggatgtcctcct
ccgtaccacacatttgaagagccaacttacgtactattaaaataa

KEGG   Felis catus (domestic cat): 807936Help
Entry
807936            CDS       T02385                                 

Gene name
COX2
Definition
(RefSeq) cytochrome c oxidase subunit II
  KO
K02261  cytochrome c oxidase subunit 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca00190  Oxidative phosphorylation
fca01100  Metabolic pathways
fca04260  Cardiac muscle contraction
fca04714  Thermogenesis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
fca05012  Parkinson disease
fca05016  Huntington disease
Module
fca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    807936 (COX2)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    807936 (COX2)
  09159 Environmental adaptation
   04714 Thermogenesis
    807936 (COX2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    807936 (COX2)
   05012 Parkinson disease
    807936 (COX2)
   05016 Huntington disease
    807936 (COX2)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    807936 (COX2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    807936 (COX2)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA-encoded proteins
   Cytochrome c oxidase
    807936 (COX2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: COX2 COX2_TM
Motif
Other DBs
NCBI-GeneID: 807936
NCBI-ProteinID: NP_008254
UniProt: P48890
Position
MT
AA seq 227 aa AA seqDB search
MAYPFQLGFQDATSPIMEELLHFHDHTLMIVFLISSLVLYIISLMLTTKLTHTSTMDAQE
VETIWTILPAIILILIALPSLRILYMMDEINNPSLTVKTMGHQWYWSYEYTDYEDLNFDS
YMIPTQELKPGELRLLEVDNRVVLPMEMTIRMLISSEDVLHSWAVPSLGLKTDAIPGRLN
QTTLMATRPGLYYGQCSEICGSNHSFMPIVLELVPLTYFEKWSASML
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atggcgtacccctttcaactaggtttccaagatgctacatcccccattatagaagaactc
ctacactttcacgaccacacactaataattgtatttttaatcagctctttagttctttat
attatctcgttgatgctaacaaccaagctcacgcacacgagtacaatagatgctcaagaa
gtagaaaccatctgaaccatcctacctgctattatcctgattcttatcgccctaccctcc
ttacgaattctctatataatggatgaaatcaacaacccctccctcacagtaaaaaccata
ggacatcaatgatattgaagttatgagtacactgattacgaagacttgaattttgactct
tacataattcctacccaagagctaaaaccaggagaactccggctattagaagttgacaac
cgagtagttttaccaatagaaatgaccattcgcatgttaatctcatcagaagatgtgtta
cactcatgagccgtcccatccctaggcctaaaaactgatgctatcccaggccgattaaat
caaacaactctaatagctacacgacctggtttatattatggccaatgctcagaaatctgt
ggctcaaaccatagcttcatacccattgttcttgaattagtcccactaacgtactttgaa
aaatgatctgcatctatactgtaa

DBGET integrated database retrieval system