KEGG   Felis catus (domestic cat): 101082104Help
Entry
101082104         CDS       T02385                                 

Gene name
PIK3R6
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 6 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04371  Apelin signaling pathway
fca04611  Platelet activation
fca04725  Cholinergic synapse
fca04921  Oxytocin signaling pathway
fca05145  Toxoplasmosis
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101082104 (PIK3R6)
   04072 Phospholipase D signaling pathway
    101082104 (PIK3R6)
   04022 cGMP-PKG signaling pathway
    101082104 (PIK3R6)
   04151 PI3K-Akt signaling pathway
    101082104 (PIK3R6)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101082104 (PIK3R6)
   04062 Chemokine signaling pathway
    101082104 (PIK3R6)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101082104 (PIK3R6)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101082104 (PIK3R6)
  09156 Nervous system
   04725 Cholinergic synapse
    101082104 (PIK3R6)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101082104 (PIK3R6)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082104 (PIK3R6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101082104 (PIK3R6)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101082104 (PIK3R6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_1B_p101
Motif
Other DBs
NCBI-GeneID: 101082104
NCBI-ProteinID: XP_023099356
Position
E1
AA seq 755 aa AA seqDB search
MESSDAELDLQRSVQAVLRELGAQAPSLQSNQGMWRWSLHKKVERDPGKSPALVRILLRE
LEKAESEDIRHAIIPLLHTLMYVLTKATGITEELYRRTYTFCTRLLTLPAPYCTVALDCA
IRLKTETAVPGTLYQRLVIAEQNLTSELYPYQERAFLFVDPELVSPSVCSALLLELEAAQ
AQQTPEACMRHVVAHALQAALGDACHAGALQRKLQASPRQALERYFHAVVAAVEQMASEP
SPSREGHLERLEEIYCSLLGPEAAARGRCGGDPLQSPQPNIPLPSPHITFHLWTDEEQLW
KELVLFLRPRSQLCLSADLEALDLQGLWPDRELARVSMLSTDSGIERDLPPGADELPLPG
SPEMERARLQRKGGVKKRVRLPDVLMPACWDGPPGLHRRTGRPSGDGELLPGVSRLHTAR
VLVLGDDRMLGRLAQAYHSLRKRETQKCCLTPRLSLQLYYIPVLAPEKQASCRHSELREL
ATFLGRADPWYESTVNTLCPAIHKLAEMPPSLDTSRTVDPFILDVITYYLRMGTQPVYFQ
IYTVKIFRDLSQHPAEDIFLTELKVKIQDTKPPKDGFSPRRRGAAEGPGAELHICYQKAL
LSHRAQEVAVSLRATGLVLKTFAASDTEVSGPAPAPPPAVPVTDHTCLNVSVTEVIKSSN
LAGRSFSMVTNTFRTANIQIQSQDQRLLTLLLDKDSRRAFKDVVRFEVSPCPEPCSEAHK
SEASQLGSHGQEVEGTKAKPKPLLMPINTFSGIVQ
NT seq 2268 nt NT seq  +upstreamnt  +downstreamnt
atggagagctcagatgctgagctggatctccaacggagcgtgcaggccgtgctccgggag
ctcggcgcccaggccccgtccctgcagagcaaccaaggcatgtggagatggtccctgcat
aagaaggtggagcgagatcctgggaagagtccggctctggtccgcattctgctcagagaa
ctggagaaggcagagagtgaggacatccggcatgcgatcattcccttgctgcacacgcta
atgtatgtgctcactaaggccacgggcatcacggaggagctctaccggaggacctacacc
ttttgcacaaggttgctaaccctgcccgccccctactgcacggtcgccttggactgcgcc
ataaggctgaaaaccgagactgctgtcccagggacactgtaccaaaggctggtcattgcc
gagcagaacctgacgagtgagctgtacccctaccaggagagagcattcctcttcgtggac
cccgagctggtgtccccgtccgtgtgcagcgcgctgctgctggagctcgaggcggcgcag
gcgcagcagacgcccgaggcctgcatgcgccacgtggtcgcccacgccctgcaggccgcc
ctgggggacgcctgccacgcaggcgctctgcagaggaagctgcaggccagccctcgccag
gccctggagcgctatttccacgccgtggtggcagccgtggagcagatggccagcgagccc
agcccgagccgggagggacacctggagaggctggaggagatttactgctcgctgctgggg
ccggaggcggccgccagggggcgctgcggcggtgaccccctgcagtccccgcagccaaac
atccctctgcccagcccccacatcaccttccacctgtggacggatgaagaacagctctgg
aaggaactggtgctcttcctgcgcccgcgatcccagctgtgcctcagcgccgacttggag
gccttggatctgcagggcctctggccggaccgggagctggcccgggtgtccatgctgtcc
acagacagcggcatcgagcgggaccttcctccgggggccgacgagctgcccctacccggc
agccccgagatggagcgcgccaggctgcagcgcaaaggcggcgtcaagaagcgggtgcgg
ctcccggacgtcttgatgcccgcgtgctgggacgggcccccgggtctacaccgcaggacg
ggcaggcccagtggggacggggagctactgcctggtgtgtcgcggcttcacacggccagg
gtgctggtgctgggggacgacaggatgctggggcgcctggcccaggcctaccacagcctc
aggaaacgagaaacccagaagtgctgcctcacccccaggctcagtctgcagctgtactac
atccccgtgctggcacccgagaaacaggcatcatgcagacattcggagctcagagagctg
gccacattcctgggccgcgcagacccgtggtatgagagcaccgtgaacacactgtgcccg
gccatccacaagctggcagagatgcctccctccctggacacatcccggaccgtggacccc
ttcatcctggatgtcatcacctattaccttcgcatgggcacccaacccgtctacttccag
atctacacagtcaagatcttcagggacctgagccaacaccctgcagaggacatttttctc
actgagctcaaggtgaagattcaagacaccaagccccccaaagatggcttttcacccagg
aggaggggcgcagccgagggcccaggggctgagctccacatttgctaccagaaggccctg
ctcagccaccgggcccaagaggtcgccgtttccctgcgggccactgggctggtcctgaag
acctttgcagccagtgacactgaagtttctgggcccgcccccgccccgccacctgctgtc
cccgtgacagaccacacgtgcctgaacgtcagcgtgacggaggtcatcaagtcctccaac
ttggcgggaaggtccttctctatggtgacaaacaccttccggacggccaacatccagatc
cagagccaggaccagaggctcctgacgctgctcctggacaaggacagtcggcgagcgttc
aaggacgtggtcagattcgaggtctctccctgcccagagccatgttccgaggcccacaag
tccgaggcgtcacagctcggttcacacgggcaggaggtggaagggaccaaagccaagccc
aagccccttctaatgcccatcaacacgttctccggcatcgtccagtga

KEGG   Felis catus (domestic cat): 101082354Help
Entry
101082354         CDS       T02385                                 

Gene name
PIK3R5
Definition
(RefSeq) phosphoinositide 3-kinase regulatory subunit 5 isoform X1
  KO
K21290  phosphoinositide-3-kinase regulatory subunit 5/6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04371  Apelin signaling pathway
fca04611  Platelet activation
fca04725  Cholinergic synapse
fca04921  Oxytocin signaling pathway
fca05145  Toxoplasmosis
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101082354 (PIK3R5)
   04072 Phospholipase D signaling pathway
    101082354 (PIK3R5)
   04022 cGMP-PKG signaling pathway
    101082354 (PIK3R5)
   04151 PI3K-Akt signaling pathway
    101082354 (PIK3R5)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101082354 (PIK3R5)
   04062 Chemokine signaling pathway
    101082354 (PIK3R5)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101082354 (PIK3R5)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101082354 (PIK3R5)
  09156 Nervous system
   04725 Cholinergic synapse
    101082354 (PIK3R5)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101082354 (PIK3R5)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082354 (PIK3R5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101082354 (PIK3R5)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101082354 (PIK3R5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3K_1B_p101 DUF2284
Motif
Other DBs
NCBI-GeneID: 101082354
NCBI-ProteinID: XP_023099265
Ensembl: ENSFCAG00000029534
Position
E1
AA seq 871 aa AA seqDB search
MQPGATTCTEDRIQHALERCLHGLSLSRCSTSWSAGLCLNCWSLQELVSRDPGHFLILLE
QILQKTREVQEKGTYDLLAPLALLFYSTVLCTPHFPPDSDLLLKAARTYHRFLTWPVPYC
SICQELLTFIDAELKAPGISYQRLVRAEQGLSIRSHRSSTVTVLLLNPVEVQAEFLAVAN
RLSAPGHSPHSAYTTLLLHAFQATFGAHCDLPGLHCRLQSKSLAELEDIFTETAEAQELA
SSIGDAAEARQWLRTKLQAVGEKAGFPGVLDTAKPGKLCTIPIPVARCHTYNWNQDSFDV
LQEILLQEQELLQPGILGDEEEEEEEEEDDDDLETEGRCAQRDSLLSTSSAVFHDSTLSL
ASPQASGPTLSRQLLTSFVSGLSDGVDSGYVEDSEDSSSSEWPKRPGGQGRRLHRRPGQK
FNRICKLFKSTSQLVLRRDSRGAEGGADAALPLRRAGSLCGPLDGAAPPPASRPQRSRSL
PQPKLSAQLPSWLLAPASRHQRRRPFLSGDEDPKASTLRVVVFGSDRISGKVARAYSNLR
RLENNRPLLTRLFKLQFFYVPVKRGSGACPSPASQTPPLPADSPRQPSPAELESTNDISH
YLGMLDPWYERNVLGLMHLPPEVLCQQSLKAESRPLDGSSAQLPILADMLLYYCRFAARP
VLLQVYQTELTFVTGEKMTEIFLHSLELGHSAATRAIKASGPGSKRLGIDGDREAIPLTL
QIIYSKGAISGRSRWSSMEKVCTSVNLSKACRKPEELDSSMEALTLNLTEVVKRQNPKSK
KGFNQISTSQMKVDKIQIIGSNGCSFAVCLDQDERKIVQSVVRCEVSPCYKPEKSGLRPQ
PQRTPDQPAQAVPDLCSLLCLPIMTFSGALP
NT seq 2616 nt NT seq  +upstreamnt  +downstreamnt
atgcagccaggggccacgacgtgcacggaggaccgtatccagcatgccctggagcgctgc
ctgcatggcctcagcctcagccgctgctctacctcctggtcagccgggctgtgtctcaac
tgctggagcctgcaggagctggtcagcagggatccgggccacttccttatcctcctggag
cagatcttgcagaagactcgagaggtccaggagaagggcacctatgaccttctcgccccc
ctggctctgcttttctactccactgttctctgcacaccacacttcccgccagattcagat
ctccttctgaaagcagccagaacctaccaccgcttcctgacctggcctgttccctactgc
agtatctgccaggagctgctcaccttcattgatgctgaactcaaggccccaggaatctcc
taccaacggctggtgagggccgagcagggcctgtccatcaggagtcaccgcagttctacc
gtcaccgtgctgttgttgaacccggtggaggttcaggccgagttcctcgccgtggccaat
aggctgagtgcacccggccactcgccccacagcgcctacaccacgctgctccttcacgcc
ttccaggccaccttcggggcccactgcgacctcccaggcctgcactgcaggctgcagtcc
aagagcctggccgagctggaagacatcttcacggagaccgcggaggcacaggagctggcg
tccagcatcggggacgcggccgaggcccggcagtggctcaggaccaagctgcaggcggtg
ggagagaaagccggcttccctggtgtcttagacacggccaaacccggcaaactctgcacc
atccccatcccggtggccaggtgccacacctacaactggaaccaggacagcttcgacgtc
ctgcaggaaatcctgctccaagaacaggagctgctccagccagggatcctgggggacgag
gaggaggaagaggaggaggaggaggacgacgacgacttggagacggaagggcgttgtgcc
cagagggactccctgctctccaccagctccgcggtcttccacgactccaccctgtccctt
gcctcgccccaggcctcagggcccaccctgtcccgccagctgctgacctccttcgtgtca
ggcctctcggacggcgtggacagcggctacgtggaggacagcgaggacagctcctcctcg
gagtggcccaagaggcctggcggccaggggcgccggctccaccgccggccggggcagaag
ttcaacaggatctgtaaactgttcaagagcacgagccagctggtgctgcggcgggactcc
cggggcgcggagggcggcgcggacgcagccctgcccctgcgacgggcggggagcctctgc
ggccccctggacggcgcggccccgccgccggcctcccggccccagcgctcccgctctctg
ccgcagcccaagctcagcgcccagctgcccagctggctcctggcccccgcctcccgccac
cagcgccggcgccccttcctgagcggggatgaggaccccaaggcgtccacgctccgcgtc
gtggtcttcggctccgatcggatttcggggaaggtggctcgggcctacagcaatctgcgg
cggctggagaacaaccgccccctcctcacgcggttgttcaaactccaattcttctacgtg
cccgtcaagcggggctccggcgcctgccccagccctgcgagccagacgcccccactcccc
gcggactcccccaggcaacccagccctgcagagctggagagcaccaatgatatctcccac
tacctcggcatgctcgacccctggtacgagcgcaacgtgctgggtctcatgcacctgccg
ccggaggtcctgtgccagcagtctctgaaggctgaatctcggcccctggacggctcctct
gcccagctgcccatcctggcggacatgctgctctactactgccgtttcgccgcccggccc
gtgttgctgcaggtctatcagacggagctgaccttcgtcaccggggagaagatgacagag
atcttcctccactccctggagctgggtcactctgccgccacacgtgccatcaaggcttcc
ggtcctggcagcaagcgcctgggcatcgatggtgaccgggaggccatccctctaacacta
cagattatttacagcaagggggccatcagtggccgaagccgctggagcagcatggagaag
gtgtgcacgtccgtgaacctcagcaaggcctgccggaagccggaggagctagactccagc
atggaggccctgacgctaaacctgaccgaagtggtgaagaggcagaaccccaagtccaag
aagggcttcaaccagatcagcacgtcacagatgaaagtggacaagattcagatcatcggc
tccaacggctgctccttcgcggtgtgtctggaccaggatgagaggaagatcgtgcagagt
gtggtccggtgtgaggtctcgccctgctacaagccggagaagagcggcctccgcccccaa
ccccagaggacccccgaccagccggcccaggccgtgcccgacctctgctccctcctctgc
ctgccaatcatgacgttcagcggagctctgccttag

KEGG   Felis catus (domestic cat): 101096215Help
Entry
101096215         CDS       T02385                                 

Gene name
PIK3CG
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit gamma isoform isoform X1
  KO
K21289  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit gamma [EC:2.7.1.153]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04022  cGMP-PKG signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04371  Apelin signaling pathway
fca04611  Platelet activation
fca04725  Cholinergic synapse
fca04921  Oxytocin signaling pathway
fca05145  Toxoplasmosis
fca05167  Kaposi sarcoma-associated herpesvirus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101096215 (PIK3CG)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101096215 (PIK3CG)
   04072 Phospholipase D signaling pathway
    101096215 (PIK3CG)
   04022 cGMP-PKG signaling pathway
    101096215 (PIK3CG)
   04151 PI3K-Akt signaling pathway
    101096215 (PIK3CG)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101096215 (PIK3CG)
   04062 Chemokine signaling pathway
    101096215 (PIK3CG)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101096215 (PIK3CG)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101096215 (PIK3CG)
  09156 Nervous system
   04725 Cholinergic synapse
    101096215 (PIK3CG)
 09160 Human Diseases
  09172 Infectious disease: viral
   05167 Kaposi sarcoma-associated herpesvirus infection
    101096215 (PIK3CG)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101096215 (PIK3CG)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096215 (PIK3CG)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     101096215 (PIK3CG)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101096215 (PIK3CG)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 DUF4135 DUF3244
Motif
Other DBs
NCBI-GeneID: 101096215
NCBI-ProteinID: XP_019680900
Ensembl: ENSFCAG00000004554
Position
A2
AA seq 1174 aa AA seqDB search
MPPFHCLARPIRVDIHKVPAIALQVAQGMELDNYEQPVVLREDNRRRRRRMKPRSTTASL
SSMELIPIEFVLPTSQRNSKTPETALLHVAGHGNVEQMKAQVWLRALETSVATDFYRRLG
PDHFLLLYQKKGQWYEIYDKYQVVQTLDCLRYWQVLHRSPGQIHVVQRRAPSDETLAFQR
QLTALIGYDVTDVSNVHDNELEFTRRRLVTPRMVEVAGRDPKLYAMHPWVTSKPLPEYLL
KKITNNCIFIVIHRSTTSQTIKVSADDTPGAILQSFFTKMAKKKSLMDIPESQSEQDFVL
RVCGRDEYLVGETPIKNFQWVRQCLKNGEEIHLVLDTPPDPALDEVRKEEWPLVDDCTGV
TGYHEQLTIHGKDHESVFTVSLWDCDRKFRVKIRGIDIPVLPRNADLTVFVEANIQHGQQ
VLCQRRTSPKPFTEEVLWNVWLEFSIKIKDLPRGALLNLQIYCSKAPVLAGKTSAETPSS
ESKGKTQLLYYVNLLLIDHRFLLRHGEYVLHMWQISGKGEDQGSFNADKLTSATNPDKEN
SMSISILLDNYCHPIALPKHRPTPDPEGDRVRAEMPNQLRKQLEAIIATDPLNPLTAEDK
ELLWHFRYESLKHPKAYPKLFSSVKWGQQEIVAKTYQLLARREVWDQSALDVGLTMQLLD
CNFSDENVRAIAVQKLESLEDDDVLHYLLQLVQAVKFEPYHDSALARFLLKRGLRNKRIG
HFLFWFLRSEIAQSRHYQQRFAVILEAYLRGCGTAMLHDFTDQVQVIEMLQKVTLDIKSL
SAEKYDVSSQVISQLKQKLENLQNSNLPKSFRVPYDPGLKAGALVIEKCKVMASKKKPLW
LEFKCADPTALSNETIGIIFKHGDDLRQDMLILQILRIMESIWETESLDLCLLPYGCIST
GDRIENQTREIAAWLKSPLPSCQQRPSHSSSGSGPRPQCPSASVHLLIGMIEIVKEATTI
AKIQQSTVGNTGAFKDEVLNHWLKEKCPIEEKFQAAVERFVYSCAGYCVATFVLGIGDRH
NDNIMITETGNLFHIDFGHILGNYKSFLGINKERVPFVLTPDFLFVMGTSGKKTSLHFQK
FQDVCVKAYLALRHHTNLLIILFSMMLMTGMPQLTSKEDIEYIRDALTVGKSEEDAKKYF
LDQIEVCRDKGWTVQFNWFLHLVLGIKQGEKHSA
NT seq 3525 nt NT seq  +upstreamnt  +downstreamnt
atgcctccgtttcattgtctggccagacctatacgtgtggatatccataaggttccggcc
atagctttgcaggtcgcgcagggcatggagctggacaactatgaacagcccgtggttctg
agagaggacaaccgccgccggcgccggaggatgaagccgcgcagcaccacggccagcctg
tcctccatggagctcatccccatcgagttcgtgctgcccaccagccagcgcaacagcaag
acccccgagacggcgctgctgcacgtggccggccacggcaacgtggagcagatgaaggcc
caggtgtggctgcgcgcgctggagactagcgtggcgaccgacttctaccgccggctcggc
ccggaccacttcctcctgctctaccagaagaagggccagtggtatgagatctacgacaag
taccaggtggtgcagaccctggactgcctgcgctactggcaggtgctgcacaggagcccg
ggccagatccacgtggtgcagcggcgcgcgccctccgacgagacgctggccttccagcgg
cagctcaccgccctgatcggctacgacgtcaccgacgtcagcaacgtgcacgataacgag
ctcgagttcacgcgccgccgcctggtcaccccgcgcatggtcgaggtggccggccgcgac
cctaagctctacgccatgcacccgtgggtgacatcgaagcccctcccggagtatctgttg
aagaagatcaccaacaactgcatcttcatcgtcattcaccgcagcaccaccagccagacc
atcaaggtctcggccgatgacaccccaggcgccatcctccagagcttcttcaccaagatg
gccaagaagaagtctctgatggatatccccgaaagccagagcgaacaggattttgtgctc
cgcgtctgcggccgggatgagtacctagtgggtgaaacgcccatcaaaaactttcagtgg
gtgaggcaatgcctcaagaatggagaagagattcacctggtgcttgacacgcctccagac
ccagccctggacgaggtgaggaaagaagagtggccactggtggatgactgcacgggagtc
actggctaccatgagcagctgaccatccacgggaaggaccacgagagtgtgttcaccgtg
tccctgtgggactgtgaccggaagttcagggtcaaaatcagaggcattgatatccccgtc
ctgccccggaatgctgacctcacggtttttgtggaggcaaacatccagcatgggcagcaa
gtcctttgccaaaggagaaccagccccaaacccttcacagaggaggtgctctggaatgtg
tggctcgagttcagtatcaaaataaaagacttacccagaggggctctactcaacctccag
atctactgcagcaaagctccggtgctggctggcaagacctctgcagagactcccagttcc
gagtccaaaggcaaaactcagctcctctattacgtgaacctgctgctgatagaccaccga
ttcctcctgcgccacggggagtatgtgctccacatgtggcagatatctggaaagggagaa
gaccaagggagcttcaatgctgacaagctcacgtctgcgacaaacccagacaaggagaac
tcaatgtccatctccattctcctggacaattactgtcacccaatagccttgcctaagcat
cgccccacccctgaccccgaaggggaccgggttcgagcagaaatgcccaaccagcttcgg
aagcaactggaagcaatcatagccactgatccacttaaccctctcacagcagaggacaaa
gaattgctctggcattttagatatgaaagccttaagcatccaaaggcatatcctaagctg
tttagctccgtaaaatggggacagcaagaaattgtagccaaaacgtaccaattgttagcc
agacgggaggtctgggatcaaagtgctttggatgtggggttaacaatgcaactcctggac
tgcaacttttcagatgaaaatgtaagagccattgcagtgcagaaactggagagcttggag
gacgatgatgttctgcattacctcctacagctggtccaggctgtgaaatttgaaccctat
catgacagcgccctcgccagatttctgctgaagcgtggcttacgaaacaaaagaattggt
cacttcttgttttggttcttgagaagcgagatagcacagtccagacactaccagcagagg
tttgcagtgatcctagaagcctacctgaggggctgtggcacagccatgctgcatgacttc
accgaccaagtgcaagtgatcgagatgctacagaaggtcacccttgatattaaatcgctc
tctgctgaaaagtatgatgtcagttcccaagttatttcacaacttaagcaaaaacttgaa
aacctgcagaattcgaatctcccaaaaagctttagagtcccgtatgatcctggactgaag
gccggagcactagtgattgaaaaatgtaaagtgatggcctccaagaaaaagcccctatgg
cttgagtttaaatgtgccgaccctacagccctatcaaatgaaacgattggcattatcttt
aaacatggtgatgatctgcgccaagacatgctgattttacagattctacgaatcatggaa
tccatttgggagactgaatctctggatctgtgcctcctgccatatggttgcatttcaact
ggtgacagaatagaaaaccaaaccagggaaatagccgcctggttgaaaagccctctgccc
tcctgtcaacagagacccagccattcctcctctgggtcaggccccaggccccagtgtcca
tcagcctctgtacatcttctcataggaatgatcgagatcgtgaaagaggccacgacaatt
gccaaaattcagcaaagcaccgtgggcaacacgggcgcgtttaaagatgaagtcctgaat
cactggctcaaggagaaatgccctattgaagaaaagtttcaggcagcagtggagagattt
gtttattcctgtgctggctactgtgtggctacctttgttcttggaataggcgacaggcac
aacgacaatattatgatcacagagacaggaaatctatttcatattgactttggacacatt
cttgggaattacaaaagttttctgggcatcaataaagagagagtgccatttgtgctaacc
ccagacttcctgtttgtgatgggaacttctggaaagaagacaagcctgcacttccagaaa
tttcaggacgtctgcgttaaggcttacctcgcccttcgtcatcacacaaacctgctgatc
atcctcttctccatgatgctgatgacaggaatgccccagttaacaagcaaagaagatatt
gaatatattcgggatgccctaacagtggggaaaagtgaggaggatgctaagaagtatttt
cttgatcagatcgaagtgtgtagagacaaaggatggaccgtgcagtttaactggttcctg
catcttgttctgggcatcaaacaaggggagaaacattcagcctag

DBGET integrated database retrieval system