KEGG   Felis catus (domestic cat): 101082184Help
Entry
101082184         CDS       T02385                                 

Gene name
GSTP1
Definition
(RefSeq) glutathione S-transferase P
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00480  Glutathione metabolism
fca00980  Metabolism of xenobiotics by cytochrome P450
fca00982  Drug metabolism - cytochrome P450
fca00983  Drug metabolism - other enzymes
fca01524  Platinum drug resistance
fca05200  Pathways in cancer
fca05204  Chemical carcinogenesis
fca05225  Hepatocellular carcinoma
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101082184 (GSTP1)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101082184 (GSTP1)
   00982 Drug metabolism - cytochrome P450
    101082184 (GSTP1)
   00983 Drug metabolism - other enzymes
    101082184 (GSTP1)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101082184 (GSTP1)
   05204 Chemical carcinogenesis
    101082184 (GSTP1)
   05225 Hepatocellular carcinoma
    101082184 (GSTP1)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101082184 (GSTP1)
  Drug resistance
   01524 Platinum drug resistance
    101082184 (GSTP1)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101082184 (GSTP1)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   101082184 (GSTP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_C_3 GST_C GST_N GST_C_2
Motif
Other DBs
NCBI-GeneID: 101082184
NCBI-ProteinID: XP_023095898
Position
D1
AA seq 210 aa AA seqDB search
MPPYTIVYFPVRGRCEAMRMLLADQGQSWKEEVVNKETWLQGPLKASCLYGQLPKFQDGD
LTLYQSNAILRHLGRTLGLYGKDQREAALVDVVNDGVEDLRSKYITLIYTNYEAGKKEYV
KALPGHLKPFETLLSQNQGGQAFIMGDQISFADYNLLDLLLIHQVLAPGCLDSLPLLSAY
VARLSARPKLKAFLASPEHVNRPINGNGKQ
NT seq 633 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctacaccattgtctacttcccggtccgagggcgctgcgaggccatgcgcatg
ctgctggccgaccagggccagagctggaaggaagaggtggtgaacaaggagacctggctg
cagggcccgctcaaggcctcctgtctgtacgggcagctccccaagttccaggacggagac
ctcactctgtaccagtccaacgccatcctgcgacacctggggcgcacccttgggctatac
gggaaggaccagcgcgaggcagccctggtggacgtggtgaatgacggggtggaggacctt
cgcagcaaatacatcacccttatctacaccaactatgaggcaggcaagaaggaatatgtg
aaggcactgccggggcacctgaagcctttcgagacgctgctgtcccagaaccaggggggc
caggccttcatcatgggcgaccagatctccttcgcggactacaacctgctggacttgctg
ctgattcaccaggtcctggcccccggctgcctggactccctccccctgctctcggcctat
gtggcgcgcctcagcgcccggcccaagctcaaggccttcctggcctcccctgagcacgtg
aaccgtcccatcaacggcaacgggaagcagtga

DBGET integrated database retrieval system