KEGG   Felis catus (domestic cat): 101082246Help
Entry
101082246         CDS       T02385                                 

Gene name
LRP6
Definition
(RefSeq) low-density lipoprotein receptor-related protein 6
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05200  Pathways in cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101082246 (LRP6)
   04150 mTOR signaling pathway
    101082246 (LRP6)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101082246 (LRP6)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082246 (LRP6)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101082246 (LRP6)
   05226 Gastric cancer
    101082246 (LRP6)
   05224 Breast cancer
    101082246 (LRP6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101082246 (LRP6)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101082246 (LRP6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL cEGF
Motif
Other DBs
NCBI-GeneID: 101082246
NCBI-ProteinID: XP_023112552
Ensembl: ENSFCAG00000000044
Position
B4
AA seq 1613 aa AA seqDB search
MGAVLRSLLACSFCALLRAAPLLLYANRRDLRLVDATNGKENATIVVGGLEDAAAVDFVF
GHGLIYWSDVSEEAIKRTEFNKTESVQNVVVSGLLSPDGLACDWLGEKLYWTDSETNRIE
VSNLDGSLRKVLFWQELDQPRAIALDPSSGFMYWTDWGEVPKIERAGMDGSSRFIIINTE
IYWPNGLTLDYEEQKLYWADAKLNFIHKSNLDGTNRQAVVKGSLPHPFALTLFEDTLYWT
DWNTHSILACNKYSGEGLREIHSNIFSPMDIHAFSQQRQPNATNPCGIDNGGCSHLCLMS
PVKPFYQCACPTGVKLLENGKTCKDGATELLLLARRTDLRRISLDTPDFTDIVLQLEDIR
HAIAIDYDPVEGYIYWTDDEVRAIRRSFIDGSGSQFVVTAQIAHPDGIAVDWVARNLYWT
DTGTDRIEVTRLNGTMRKILISEDLEEPRAIVLDPMVGYMYWTDWGEIPKIERAALDGSD
RVVLVNTSLGWPNGLALDYDEGKIYWGDAKTDKIEVMNIDGTGRRVLVEDKIPHIFGFTL
LGDYVYWTDWQRRSIERVHKRSAEREIIIDQLPDLMGLKATNVHRIIGSNPCAEENGGCS
HLCLYRPQGLRCACPIGFELISDMKTCIVPEAFLLFSRRADIRRISLETNNNNVAIPLTG
VKEASALDFDVTDNRIYWTDISLKTISRAFMNGSALEHVVEFGLDYPEGMAVDWLGKNLY
WADTGTNRIEVSKLDGQHRQVLVWKDLDSPRALALDPAEGFMYWTEWGGKPKIDRAAMDG
SERTTLVPNVGRANGLTIDYAKRRLYWTDLDTNLIESSNMLGLNREVIADDLPHPFGLTQ
YQDYIYWTDWSRRSIERANKTSGQNRTIIQGHLDYVMDILVFHSSRQAGWNECASSNGHC
SHLCLAVPVGGFVCGCPAHYSLNADNRTCSAPTTFLLFSQKSAINRMVIDEQQSPDIILP
IHSLRNVRAIDYDPLDKQLYWIDSRQNMIRKAQEDGSQGFTVVVSSVPNQNLEIQPYDLS
IDIYSRYIYWTCEATNVINVTRLDGRSIGVVLKGEQDRPRAIVVNPEKGYMYFTNLQERS
PKIERAALDGTEREVLFFSGLSKPIALALDSRLGKLFWADSDLRRIESSDLSGANRIVLE
DSNILQPVGLTVFENWLYWIDKQQQMIEKIDMTGREGRTKVQARIAQLSDIHAVKELNLQ
EYRQHPCAQDNGGCSHICLVKGDGTTRCSCPMHLVLLQDELSCGEPPTCSPQQFTCFTGE
IDCIPVAWRCDGFTECEDHSDELNCPVCSESQFQCASGQCIDGALRCNGDANCQDKSDEK
NCEVLCLIDQFRCSNGQCIGKHKKCDHNVDCSDKSDELDCYPTEEPAPQATNTVGSVIGV
IVTIFVSGTIYFICQRMLCPRMKGDGETMTNDYVVHGPASVPLGYVPHPSSLSGSLPGMS
RGKSMISSLSIMGGSSGPPYDRAHVTGASSSSSSSTKGTYFPAILNPPPSPATERSHYTM
EFGYSSNSPSTHRSYSYRPYSYRHFAPPTTPCSTDVCDSDYAPSRRMTSVTTAKGYTSDL
NYDSEPVPPPPTPRSQYLSAEENYESCPPSPYTERSYSHHLYPPPPSPCTDSS
NT seq 4842 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgtcctgaggagcctcctggcctgcagtttctgtgcgctcctgagagcggcc
cctttgttgctttatgcaaacagacgggacttgcgattggttgatgctacaaatggcaaa
gagaatgctacgattgtagttggaggcttggaggatgcagctgcggtggactttgtgttt
ggtcatggcttgatatactggagtgatgtcagcgaagaagccattaaacgaacagagttt
aacaaaactgagagtgtacagaatgttgttgtctctggattattgtcccctgatggactg
gcatgcgattggcttggagaaaaattatactggacagattctgaaacaaatcggattgaa
gtttctaatttagatggatctttacgaaaagttttattttggcaagagttggatcaaccc
agagctattgccttagatccttcaagtgggttcatgtactggacagactggggagaagta
ccaaagatagaacgtgctggaatggatggttcaagtcgcttcattataataaacactgaa
atttactggccaaatggactgactttggattatgaggaacagaagctttattgggcagat
gcaaaactcaatttcatccacaaatcaaatctggatggaacaaatcggcaggcagtggtt
aaaggttcccttccacatccttttgccttgacattatttgaggacacattgtactggact
gactggaatacacactccattttggcttgcaacaagtattctggcgagggtctgcgtgaa
atccattctaacatcttctctcccatggatatacatgccttcagccaacagaggcagcca
aatgctacaaatccatgtggaattgataatggtggttgttcccacttgtgtttgatgtct
ccagtcaagcctttctatcagtgtgcttgcccaaccggggtcaaactcctggagaacgga
aaaacctgcaaagatggtgccactgaattactgcttttagcccgaaggacagacttgaga
cgcatttctttggatacaccagatttcacagacattgttttacagttagaagacatccgt
catgccattgccatagattatgatcctgtggaaggctatatctactggactgatgatgaa
gtgagggccatacgccgctcattcatagatggatccggcagtcagtttgtggtcaccgct
cagattgcgcatcctgatggtattgctgttgactgggttgcccgaaatctttattggaca
gacactggcactgatcggatagaagtaacaaggctcaatgggaccatgaggaagatcttg
atttcagaggacttagaggaaccccgggctattgtgttagatcccatggttgggtacatg
tattggactgactggggagaaatcccgaaaattgagcgagcagctctggatggttctgac
cgagtagtgttggttaacacttctcttggttggccaaatggtttagccttggattatgat
gaaggcaaaatatactggggagatgccaaaacagacaaaattgaggttatgaatatcgat
ggcactgggagacgagtactggtggaagacaaaattcctcacatatttgggtttactctg
ttgggtgactatgtttactggactgactggcagaggcgtagcatcgaaagagtacacaaa
cgaagtgcagagagggagatcatcatagatcaacttcctgatctcatgggcctaaaggcc
acaaatgttcatcgaatcattggttccaacccttgtgcagaggaaaatgggggatgtagc
catctttgcctatataggcctcagggccttcgttgtgcctgccccattggctttgaactc
atcagtgacatgaagacttgcattgtcccagaggctttccttttgttttcacggagagca
gatatcaggcgaatttctttggaaactaacaataataacgtggccattcctctcactggt
gtcaaagaagcttctgctttggattttgatgtgacagacaaccgaatatactggaccgat
atatcactcaagaccatcagcagagccttcatgaatggcagtgcactggaacacgtggtg
gaatttggcttagattacccagaaggcatggcagtagactggctcgggaagaacttgtac
tgggcagacacaggaacgaatcgaattgaggtgtcaaagttggatgggcagcaccgacaa
gttttggtttggaaagacctagatagtcccagagctcttgcactggaccctgctgaagga
tttatgtattggactgaatggggtggaaaacctaagatagacagagctgccatggatgga
agtgaacgtactacgttagttccaaatgtgggacgggcaaatggcctaactattgattat
gctaaaaggaggctttattggacagacctggacaccaacttaatagaatcttcaaatatg
cttggactcaaccgggaagttatagcagatgacttgcctcatccttttggcttaactcag
taccaagattacatctactggacggactggagccggcgcagcattgaacgtgccaacaaa
accagtggccaaaaccgcaccatcatccagggccatttggattatgtgatggacatcctc
gtctttcactcctctcggcaggcagggtggaatgagtgtgcttccagcaatgggcactgc
tcccacctctgcttggctgtgccagttgggggttttgtttgtggatgccctgcccactac
tctcttaacgccgacaacaggacttgtagtgctccaactactttcctactcttcagtcag
aagagtgccatcaaccgcatggtgattgatgaacagcagagccctgacatcatccttccc
atccacagccttcggaatgtccgggccattgactatgacccactggacaagcaactctat
tggattgactcacgacaaaacatgatccgaaaagcacaagaagatggcagccagggtttt
actgtggttgtgagctcagttccaaatcagaacctggaaatacaaccctatgacctcagc
attgatatttatagccgctacatttactggacttgtgaggccaccaatgtcattaacgta
acaagattagatgggagatcaattggagtggtattaaaaggcgagcaagaccgacctcga
gccattgtggtaaacccggagaaagggtatatgtattttaccaatcttcaggaaaggtct
cccaaaattgaacgggctgctttggatggaacagaacgggaggtcctctttttcagtggc
ctaagtaaaccaattgcattagcccttgatagcagattgggcaagctcttttgggcagat
tctgatctccgtcgaatcgaaagcagtgatctctcaggtgccaaccggatagtattagaa
gactccaatatcttgcagcctgtgggactgactgtgtttgaaaactggctatattggatt
gacaagcagcagcaaatgattgaaaaaattgacatgacaggtcgagagggtagaaccaaa
gtccaggctcgaattgcccagcttagtgacattcatgcagtaaaggagctgaacctacag
gaatatagacagcacccttgtgctcaggataacggtggctgttcacatatttgtcttgta
aaaggagatggtactacaaggtgctcttgccccatgcacttggttctgcttcaggatgag
ctatcatgtggagaacccccaacatgttctcctcagcagtttacttgtttcaccggagaa
attgactgtatccctgtggcttggcggtgtgatgggtttactgaatgtgaagaccacagt
gatgagctcaattgccctgtatgctcggagtcccagttccagtgtgccagtgggcagtgt
atcgatggtgccctccgatgcaacggagatgcaaactgccaggataagtcagatgagaag
aactgtgaagtgctttgtttaattgatcaattccgctgttcaaacggtcagtgcattgga
aaacataagaaatgtgatcataatgtggattgcagtgacaaatcagatgaactggattgt
tatccaactgaggaaccagctccacaggccaccaatacagttggttcagttattggagta
attgtcaccatttttgtgtctggaaccatatacttcatctgccagagaatgttgtgtcca
cgtatgaagggagatggggaaaccatgactaatgattatgtagttcatggaccagcttct
gtgccgcttggttatgtgccacacccaagttctctgtcaggatcccttccaggaatgtct
cgaggtaaatcaatgatcagctccctcagtatcatggggggaagcagtggacccccttat
gaccgagctcatgtcacaggagcatcatcaagtagttcttcaagcaccaaaggcacttac
ttccctgcaattttgaaccctccgccatccccagccacagagcgatcacattacactatg
gaatttggttattcttcaaatagtccttccactcataggtcctacagctacaggccatat
agctaccggcactttgcaccccctaccacaccctgcagcacagatgtctgtgacagtgac
tatgctcccagccggaggatgacctcagtgacaacggccaagggctacactagtgacttg
aactatgactcagagcctgtgcccccgcctcccacgccccgaagccaatacttgtcagca
gaagagaactatgaaagctgcccaccctctccatacacagagaggagctactctcatcac
ctctacccaccaccaccctccccctgtacagactcctcctga

KEGG   Felis catus (domestic cat): 101084481Help
Entry
101084481         CDS       T02385                                 

Gene name
LRP5
Definition
(RefSeq) low-density lipoprotein receptor-related protein 5
  KO
K03068  low density lipoprotein receptor-related protein 5/6
Organism
fca  Felis catus (domestic cat)
Pathway
fca04150  mTOR signaling pathway
fca04310  Wnt signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05200  Pathways in cancer
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    101084481 (LRP5)
   04150 mTOR signaling pathway
    101084481 (LRP5)
 09150 Organismal Systems
  09152 Endocrine system
   04928 Parathyroid hormone synthesis, secretion and action
    101084481 (LRP5)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084481 (LRP5)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101084481 (LRP5)
   05226 Gastric cancer
    101084481 (LRP5)
   05224 Breast cancer
    101084481 (LRP5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101084481 (LRP5)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Low-density lipoprotein receptor (LDLR) family proteins
    101084481 (LRP5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ldl_recept_b FXa_inhibition Ldl_recept_a DUF5050 SGL Insulin_TMD
Motif
Other DBs
NCBI-GeneID: 101084481
NCBI-ProteinID: XP_023095928
Ensembl: ENSFCAG00000012666
Position
D1
AA seq 1606 aa AA seqDB search
MEAAPPRLLLLALCCSLAPAAASPLLLFANRRDVRLVDAGGVKLESTVVVSGLEDAAAVD
FQFSKGAVYWTDVSEEAIKQIYLNQTGAAVQNVVISGLVSPDGLACDWVGKKLYWTDSET
NRIEVANLNGTSRKVLFWQDLDQPRAIALDPAHGYMYWTDWGETPRIERAGMDGSTRKII
VDSDIYWPNGLTIDLEEQKLYWADAKLSFIHRANLDGSFRQKVVEGSLTHPFALTLSGDT
LYWTDWQTRSIHACNKKTGEKRKEILRALYSPMDIQVLSPERQPYFHTRCAEDNGGCSHL
CLLSPREPFYTCACPTGVQLQDNGKTCKAGAEEVLLLARRTDLRRISLDTPDFTDIVLQV
DDIRHAIAIDYDPLEGYVYWTDDEVRAIRRAYLDGSGAQTLVNTEINDPDGIAVDWVARN
LYWTDTGTDRIEVTRLNGTSRKILVSEDLDEPRAIVLHPVMGLMYWTDWGENPKIECANL
DGQERHVLVNTSLGWPNGLALDLQEGKLYWGDAKTDKIEVINVDGTKRRTLLEDKLPHIF
GFTLLGDFIYWTDWQRRSIERVHKVKATRDVIIDQLPDLMGLKAVNVAKVVGTNPCADKN
GGCSHLCFFTPRATKCGCPIGLELLSDTKTCIVPEAFLVFTSRAAIHRISLETNNNDVAI
PLTGVKEASALDFDVSNNHIYWTDVSLKTISRAFMNGSSVEHVIEFGLDYPEGMAVDWMG
QNLYWADTGTNRIEVARLDGQFRQVLVWRDLDNPRSLALDPTKGYVYWTEWGGKPRIVRA
FMDGTNCMTLVDKVGRANDLTIDYADQRLYWTDLDTNMIESSDMLGQERVVIADDLPHPF
GLTQYSDYIYWTDWNLHSIERADKTSGRNRTLIQGHLDFVMDILVFHSSRQDGLNDCTHN
NGQCGQLCLAIPGGHRCGCASHYTLDPSSRNCSPPTTFLLFSQKCAISRMIPDDQHSPDL
ILPLHGLRNVKAIDYDPLDKFIYWVDGRQNIKRAKDDGTQPFVLTSPSQSQNPDRQPHDL
SIDIYSRTLFWTCEATNTINVHRLNGDAMGVVLRGDRDKPRAIVVNAERGYLYFTNMQDR
AAKIERAALDGTEREVLFTTGLIRPVALVVDNRLGKLFWVDADLKRIESCDLSGANRLTL
EDASIVQPVGLTVLGQHLYWIDRQQQMIERVEKTTGDKRTRVQGRVAHLTGIHAVEDISL
EEFSAHPCARDNGGCSHICIAKGDGTPRCSCPVHLVLLQNLLTCGEPPTCSPDQFACATG
EIDCIPGAWRCDGFPECDDQSDEEGCPVCSAAQFPCARGQCVDLRLRCDGEADCQDRSDE
ADCDAVCLPNQFRCASGQCVLIKQQCDSFPDCIDGSDELMCEITKPPSDDTPAHGSAIGP
VVGIILSLFVMGGVYFVCQRVVCQRYTGANGPFPHEYVSGTPHVPLHFIAPGGSQHGPFT
GISCGKSVMSSVSLMGGRGGVPLYDRNHVTGASSSSSSSTKATLYPPILNPPPSPATDPS
LYNVDMFYSSNIPTAARPYRPYIIRGMAPPTTPCSTDVCDSDYSANRWKASKYYLDLNSD
SDPYPPPPTPHSQYLSAEDSCPPSPATERSYFHLFPPPPSPCTDSS
NT seq 4821 nt NT seq  +upstreamnt  +downstreamnt
atggaggcggcgccgccgcggctgctgctgctcgcgctctgctgcagcctggcccccgcc
gcggcctcaccgctcctgctgtttgccaaccgccgggacgtgcggctggtggatgccggc
ggggtcaagctggagtccaccgtcgtggtcagcggcctggaggacgcggccgccgtggat
ttccagttctccaagggagccgtgtactggacggacgtgagcgaggaggccatcaagcag
atctacctgaaccagacgggggccgccgtgcagaacgtggtcatctctggcctggtgtcg
cctgacggcctggcctgcgactgggtcggcaagaagctgtactggacggactccgagacc
aatcgcatcgaggtagccaacctcaacgggacgtcccggaaggtcctcttctggcaggac
ctcgaccagccgcgggccatcgccttggaccccgctcacgggtacatgtactggacagac
tggggagagacacctcgaatcgagcgggcaggcatggatgggagcacgcggaagatcatc
gtggactcggacatttactggcccaacgggctgaccatcgacctcgaggagcagaagctc
tactgggccgacgccaagctcagcttcatccaccgcgccaacctggacggctccttccgg
cagaaggtggtggagggcagcctgacgcacccctttgccctgacgctctccggggacact
ctgtactggacggactggcagacgcgctccatccacgcctgtaacaagaagacgggagag
aagaggaaggagatccttcgagctctctattcgcccatggatattcaagtgcttagccca
gagcggcagccttacttccacacgcggtgtgcggaggacaatggcggctgctctcacctg
tgcctgctgtccccgagggagcctttctacacgtgcgcctgccccactggcgtccagctt
caggacaacggcaagacgtgcaaggcaggggccgaggaggtgctgttgctggcccggcgg
acggacctgcggaggatctcgctggacacgccggacttcaccgacattgtgctccaggtg
gacgacatacggcacgccatcgccatcgactacgacccgctggaaggctacgtgtactgg
acggacgacgaggtgcgggccatccgcagggcgtacctggacggctctggcgcccagacg
ctggtcaacactgagatcaacgacccagatggcatcgcagtcgactgggtggcccgtaac
ctctactggacggacacgggcactgaccgcatcgaggtgacgcgcctcaacggcacctcc
cgcaagatcctggtgtccgaggacctggacgagccccgggccatcgtgctgcaccccgtg
atgggccttatgtactggacagactggggggaaaaccccaaaattgagtgcgccaacctg
gatgggcaggagcggcacgtcctggtgaacacctccctcggctggcccaacggcttggcc
ctggacctacaggagggaaagctgtactggggagatgccaagacggacaaaatcgaggtg
atcaacgtcgacgggaccaagaggcggacgctcctggaggacaagctcccgcacattttc
gggttcacgctgctaggggacttcatctactggaccgactggcaacggcgcagcatcgag
cgtgtgcacaaggtcaaggccacccgggacgtcatcatcgaccagctgcctgacctgatg
gggctcaaggctgtgaacgtggccaaggttgtcggaaccaacccgtgtgcagacaagaac
gggggctgcagccacctgtgtttcttcacgccccgcgcgaccaagtgcggctgccccatc
ggcctggagctgctgagcgacacaaagacctgcatcgtccccgaggccttcctggtgttc
acgagcagggccgccatccacaggatctccctggagaccaacaacaatgacgtggccatc
ccgctcacgggcgtcaaggaggcctccgcgctggacttcgacgtgtccaacaatcacatc
tactggacggacgtcagcctgaagaccatcagccgagccttcatgaacgggagctccgtg
gagcacgtgatcgagtttggcctcgactacccggaaggcatggccgtcgactggatgggc
cagaacctctactgggcggacaccgggaccaacaggatcgaagtggcccggctggacggg
cagttccggcaggtcctcgtgtggagggacttggacaaccccaggtcactggccctggac
cccacaaaagggtacgtctactggaccgagtggggtgggaagcccaggatcgtgcgggcc
ttcatggacgggaccaactgcatgacgctggtggacaaggtgggccgggccaacgacctc
accatcgactacgctgaccagcgtctctactggacggacctggacaccaacatgatcgag
tcgtctgacatgctgggtcaggagcgggttgtgattgccgacgacctcccacaccccttc
ggcctcacccagtacagcgattacatctactggacggactggaacctgcacagcatcgag
agggccgacaagaccagtggccggaaccgcaccctcatccagggccacctggacttcgtg
atggacatcctggtgttccactcctcccgccaggatggcctcaacgattgcacgcacaac
aacgggcagtgtggacagctgtgcctcgccatccctggcggtcaccgttgcggctgcgcc
tcccactataccctagaccccagcagccgcaactgcagcccgcccaccaccttcttgctg
ttcagccagaaatgtgccatcagccgcatgatccccgatgaccagcacagcccagacctc
atcctacccctgcacgggctgaggaacgtcaaggccatcgactacgaccccctggacaag
ttcatctactgggtggacgggcgccagaacatcaagcgagccaaggacgacgggacccag
cccttcgttttgacctctccaagccagagccaaaacccggacaggcagccccatgacctc
agcatcgacatctacagccggacgctgttctggacgtgtgaggccaccaacaccatcaac
gtccaccggctgaatggagacgccatgggtgtggtgctccgtggggaccgcgacaagcca
cgggccatcgtcgtcaacgccgagcgagggtacctgtacttcaccaacatgcaggaccga
gccgccaagattgagcgagcggccttggacggcaccgagcgtgaggtcctcttcaccacg
ggcctcatccgccccgtggccctcgtggtggacaacaggctgggcaagctcttctgggtg
gacgcggacctgaagcgtatcgaaagctgcgacctgtcaggggccaaccgcctgaccctg
gaggatgccagcatcgtgcagcccgtgggcctgaccgtgctgggccagcacctgtactgg
attgaccgccagcagcagatgatcgagcgtgtggagaagaccaccggggacaagcggact
cgagtccagggccgggtggcccacctgaccggcatccacgccgtggaggatatcagcctg
gaggagttctcggcccacccgtgtgcccgggacaacggtggctgctcccacatctgcatt
gccaagggtgacgggacaccacggtgctcatgcccagtccacctcgtgctcctgcagaac
ctgctgacctgtggtgagcctcccacgtgctcgccagaccagttcgcgtgtgccactggg
gagatcgactgcatacctggggcctggcgctgcgacggcttccccgagtgtgacgaccag
agcgacgaggagggctgcccggtgtgctcggcggcccagttcccctgcgcgcggggccag
tgtgtcgacctgcgcctgcgctgcgacggcgaggccgactgccaggaccgctcggatgag
gcggactgcgacgccgtctgcctgcccaaccagttccggtgcgccagtggccagtgtgtc
ctcatcaagcagcagtgtgattctttccctgactgcatcgacggctcggatgagctcatg
tgcgagatcaccaagccgccctccgacgacaccccggcccacggcagtgccatcgggccg
gtcgtgggcatcatcctctcgctctttgtcatgggcggggtctacttcgtctgccagcgc
gtggtgtgtcagcgctacacgggggccaacgggcccttcccgcatgagtacgtcagcggg
accccccacgtacccctgcatttcatagcccccggcggctcacagcacggccccttcaca
ggcatctcctgcggcaagtccgtgatgagctccgtgagcctgatgggcggccggggcggg
gtgcccctctacgaccggaaccacgtcaccggggcctcgtccagcagctcatccagcacc
aaggccacgctgtacccgccgatcctgaacccgccgccgtcccccgccacggacccctcc
ttgtacaacgtggacatgttctactcttccaacattcccaccgctgcgagaccctacagg
ccctacatcatccgcggcatggcacccccgacgacgccctgcagcacggatgtgtgtgac
agcgactacagtgccaaccgctggaaggccagcaagtactacctggatttgaactcggac
tcagacccctacccgccgccgcccacaccccacagccagtacctgtcggcggaggacagc
tgcccgccttcgcctgccaccgagaggagctattttcacctcttccctccccctccgtcc
ccctgcacggactcgtcctga

DBGET integrated database retrieval system