KEGG   Felis catus (domestic cat): 101082274Help
Entry
101082274         CDS       T02385                                 

Gene name
MAP2K3
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 3
  KO
K04432  mitogen-activated protein kinase kinase 3 [EC:2.7.12.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04015  Rap1 signaling pathway
fca04218  Cellular senescence
fca04620  Toll-like receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05135  Yersinia infection
fca05145  Toxoplasmosis
fca05161  Hepatitis B
fca05169  Epstein-Barr virus infection
fca05170  Human immunodeficiency virus 1 infection
fca05235  PD-L1 expression and PD-1 checkpoint pathway in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04015 Rap1 signaling pathway
    101082274 (MAP2K3)
   04010 MAPK signaling pathway
    101082274 (MAP2K3)
   04668 TNF signaling pathway
    101082274 (MAP2K3)
 09140 Cellular Processes
  09143 Cell growth and death
   04218 Cellular senescence
    101082274 (MAP2K3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    101082274 (MAP2K3)
   04664 Fc epsilon RI signaling pathway
    101082274 (MAP2K3)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101082274 (MAP2K3)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082274 (MAP2K3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101082274 (MAP2K3)
 09160 Human Diseases
  09161 Cancer: overview
   05235 PD-L1 expression and PD-1 checkpoint pathway in cancer
    101082274 (MAP2K3)
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101082274 (MAP2K3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101082274 (MAP2K3)
  09172 Infectious disease: viral
   05170 Human immunodeficiency virus 1 infection
    101082274 (MAP2K3)
   05161 Hepatitis B
    101082274 (MAP2K3)
   05169 Epstein-Barr virus infection
    101082274 (MAP2K3)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101082274 (MAP2K3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101082274 (MAP2K3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     101082274 (MAP2K3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE7 family
   101082274 (MAP2K3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase Seadorna_VP7 APH Pkinase_fungal Choline_kinase RIO1 DHR-2 DUF4344
Motif
Other DBs
NCBI-GeneID: 101082274
NCBI-ProteinID: XP_003996404
Ensembl: ENSFCAG00000014840
UniProt: M3WZ01
Position
E1
AA seq 347 aa AA seqDB search
MESPASSQPSSMPPTKGKSKRKKDLRISCMSKPPVPNPTPPRNLDSRTFITIGDRNFEVE
ADDLVTISELGRGAYGVVEKVRHAQSGTIMAVKRIRATVNSQEQKRLLMDLDINMRTVDC
FYTVTFYGALFREGDVWICMELMDTSLDKFYRKVLDKNMTIPEDILGEIAVSIVRALEHL
HSKLSVIHRDVKPSNVLINKEGHVKMCDFGISGYLVDSVAKTLDAGCKPYMAPERINPEL
NQKGYNVKSDVWSLGITMIEMAILRFPYESWGTPFQQLKQVVEEPSPQLPADSFSPEFVD
FTAQCLRKSPAERMSYLELMEHPFFTLHKTKKTDIAAFVKEILGEDS
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atggagtcgcccgcctccagtcagccctccagcatgcccccgaccaaagggaaatccaag
aggaagaaggatttacggatatcctgcatgtccaagccgcctgtacccaaccctacaccc
ccccggaacctggactctcggaccttcatcaccatcggagacaggaattttgaggtggag
gccgatgacctggtgaccatctcagagctgggccgtggagcctatggggtggtggagaag
gtgcggcatgcccagagtggcaccatcatggccgttaagcggatccgggccactgtgaac
tcacaggagcagaagcgtctgctcatggacttggacatcaacatgcgcacggtcgactgc
ttctacactgtcaccttctatggggccctcttcagagagggagatgtgtggatctgcatg
gagctcatggacacatccctggacaagttctaccggaaagtgctcgataaaaacatgacc
attccagaggacatcctgggggaaattgccgtgtctatcgtccgggcactggagcatctg
cacagcaagctgtccgtgatccacagagatgtgaagccgtccaatgtcctcatcaacaag
gagggtcatgtgaagatgtgcgacttcgggattagcggctatttggtggactctgtggcc
aagacgctggatgctggctgcaagccctacatggctcccgagagaatcaacccggagctg
aaccagaagggctacaacgtcaagtccgacgtctggagcctcggcatcaccatgatcgag
atggccattctacggtttccttatgaatcctgggggaccccgttccagcagctgaaacag
gttgtggaggagccatctccccagctcccagctgactcgttctctcccgagtttgtggac
ttcaccgcacagtgcctgaggaagagccccgcggagcgcatgagctacctggagctgatg
gagcaccctttcttcaccttgcacaaaaccaagaagacggacattgctgcctttgtgaag
gagatcctgggggaggactcgtag

DBGET integrated database retrieval system