KEGG   Felis catus (domestic cat): 101082365Help
Entry
101082365         CDS       T02385                                 

Gene name
MYL10
Definition
(RefSeq) myosin regulatory light chain 10
  KO
K12756  myosin regulatory light chain 10
Organism
fca  Felis catus (domestic cat)
Pathway
fca04510  Focal adhesion
fca04670  Leukocyte transendothelial migration
fca04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cellular community - eukaryotes
   04510 Focal adhesion
    101082365 (MYL10)
  Cell motility
   04810 Regulation of actin cytoskeleton
    101082365 (MYL10)
 Organismal Systems
  Immune system
   04670 Leukocyte transendothelial migration
    101082365 (MYL10)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Myosins
     101082365 (MYL10)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_5
Motif
Other DBs
NCBI-GeneID: 101082365
NCBI-ProteinID: XP_023102519
Ensembl: ENSFCAG00000018080
Position
E3
AA seq 173 aa AA seqDB search
MAPRRARKRAEGGASSNVFSMFDQSQIQEFKEAFTIMDQNRDGFIDKEDLRDTFCCLGCV
TSSCRINVKNEELEAMVKEAPGPINFTVFLTMFGEKLKGTDPEETILHAFKVFDTEGKGF
VKADFIKEKLMTQADRFSEEEVKQMFAAFPPDVCGNLDYRSLCYIITHGEEKD
NT seq 522 nt NT seq  +upstreamnt  +downstreamnt
atggcaccgagaagggcccgcaagagagcggagggcggagccagctccaatgtcttctcc
atgtttgatcagtcccagatccaggagtttaaagaggccttcaccatcatggaccagaac
cgggatggcttcatcgacaaggaggacctgagagacaccttttgctgccttgggtgcgtg
accagcagctgccgcatcaacgtgaagaacgaggagctggaggccatggtgaaggaggcc
cccgggcccatcaacttcaccgtcttcctgaccatgttcggggagaagctgaagggaacg
gacccagaggagaccattctccacgccttcaaggtgtttgacaccgaagggaaaggtttc
gtcaaggctgatttcatcaaagagaaactcatgacccaggcggaccggttcagtgaggag
gaggtcaagcagatgttcgcggctttccctccagacgtgtgtggcaacctggactacagg
agcctgtgctacatcatcacccatggtgaagagaaggactag

DBGET integrated database retrieval system