KEGG   Felis catus (domestic cat): 101082534Help
Entry
101082534         CDS       T02385                                 

Gene name
WIPF2
Definition
(RefSeq) WAS/WASL-interacting protein family member 2 isoform X1
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101082534 (WIPF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101082534 (WIPF2)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101082534 (WIPF2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2 CAP_N
Motif
Other DBs
NCBI-GeneID: 101082534
NCBI-ProteinID: XP_011287456
Position
E1
AA seq 440 aa AA seqDB search
MPIPPPPPPPPGPPPPPTFNQANTEPPKLSRDEQRGRGALLQDICKGTKLKKVTNVNDRS
APILEKPKGSSGGYGSGAVALQPKGSLFQGGVPKLRPVGAKDGSENLAGKPALQVPSSRA
AAPRPPVSTVSGRPQDDTDSSRASLPELPRMQRPSLPDLSRPNTTSSTGMKHSSSAPPPP
PPGRRANAPPTPLPVHSNKALAYNREKPLPPTPGQRLHLGREGPPAPPPVKPPPSPVNIR
TGPSGQSLAPPPPPYRQPPGVPNGPSSPTNESAPELPQRHNSLHRKTPGPVRGLAPPPPT
SASPSLQSNRPPPPARDPPSRGAAPLPPPPMIRNGARDAPPPPPPYRMHGSEPLSRGKPP
PPPSRTPAGPPPPPPPPLRNGHRDSITTVRSFLDDFESKYSFHPVEDFPAPEEYKHFQRI
YPSKTNRAARGAPPLPPILR
NT seq 1323 nt NT seq  +upstreamnt  +downstreamnt
atgccaattcctcctccccctccaccgccccctggtcctcctccacctcccacttttaat
caggcaaacacagagccgcccaagctgagtagagatgagcagcggggtcgaggtgcccta
ttacaggatatctgcaaagggaccaagctgaagaaggtgaccaatgttaatgatcggagt
gctcccatccttgagaaacccaaaggaagcagtggtggttatggctctggagcagttgcc
ctgcagcccaagggaagtctcttccaagggggagtgccgaagctccgacctgtgggagcc
aaggatggttcagagaacctagctggtaagccagccctacaagtccccagttctcgagct
gctgccccaaggccaccggtgtctacagtcagtgggcgccctcaagatgatacagacagc
agccgagcctcactcccagaactgccccggatgcagagaccatcgttaccggacctctct
aggcctaataccaccagcagtacaggcatgaagcacagcagctctgcccctcctccacca
cccccggggcggcgggccaacgctccccctacacctctgcctgtgcacagcaacaaagcc
ctagcctacaacagagagaaacccttgccgcccacacctggacaaaggctgcaccttggt
cgagagggacctcctgctccacccccagtcaaaccacctccttcccctgtgaatattaga
acgggaccaagtggccagtctctggctcctcctcctccgccttaccgccagcctcctggg
gtccccaatggaccctccagtcccactaacgagtcagcccctgagctgccccagagacac
aattctttgcataggaagacaccggggcctgtcagaggcctagcgcctcctccacccacc
tcagcctctccctcactacagagtaataggccaccacccccagcccgggaccctcccagt
cggggagcagctcctctacccccaccacccatgatccgaaatggtgccagggatgctccc
cctcccccaccaccataccgaatgcatgggtcagaacccctgagccgaggaaagccccca
cctcctccctcaaggacgccagctggaccaccccctcctcctccaccacccctgaggaat
ggccacagagattctattaccactgtccgatctttcttggatgattttgagtcaaagtat
tctttccatccagtagaagactttcctgctccagaagaatataaacactttcaaagaata
tatcccagcaaaacaaaccgagctgcccgtggagccccacctctgccacccattctcagg
tga

KEGG   Felis catus (domestic cat): 101094008Help
Entry
101094008         CDS       T02385                                 

Gene name
WIPF3
Definition
(RefSeq) WAS/WASL-interacting protein family member 3
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101094008 (WIPF3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101094008 (WIPF3)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101094008 (WIPF3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2
Motif
Other DBs
NCBI-GeneID: 101094008
NCBI-ProteinID: XP_023097941
Position
A2
AA seq 606 aa AA seqDB search
MADERRSREIKYLLRVAQRVESLHFVTCMLSLVPPGLQGCSYGRDGWDMPSKPKTASDVF
LLAALHAVPPGRLTLFREESAKGGQKLKTPAFRPAASGGMEKESRGLTLRKKEVGQHGPP
TGGSMLPDEGVSADCVITCGSNRIPLIPLQVGTDASSLRKADPKGRSALLADIQQGTRLR
KVTQINDRSAPQIESSKGGNKEGGGSANSRGGSTPPALGDLFAGGFPVLRPAGQRDAAGG
KTGQAPGSRAPSPRLPIKTISGPLNPPASPRLGSASEVHGAARTVPPRPSMPAPPPPTPP
PPPPPLPPPLPPSSPTKTPLVSPPGPPTKGNPPGAVPPLPSVPPPPPPPPPPTPPPLPLA
SVLSDKAVKPQLTPLHLPPIPPPLPLLPPCGYPGLSADATSPAQDVREPPAPPPPPPPPP
LYASCTPRSSVPAPPLPGANNSSEAPPPLPPKSPSFQAQPPKSSVQALPTPPAPPGSQTF
VQKRPGRGPGTSGGKLNPPPAPPARSPTTELSSRSQQAPAWTPTPQPGGQLWNGSLHIID
DFESKFTFHTVEDFPPPDEYKPSQKSYPSKIPRSRTPGPWLHAEAAGQSSDDIKGRNSQL
SLKTLR
NT seq 1821 nt NT seq  +upstreamnt  +downstreamnt
atggcggacgaacggcggtccagagagattaagtacttgctcagagtcgcacaacgggtg
gagtctttgcacttcgtcacctgcatgctgtcccttgtaccgcccggcctccagggctgc
agttatggcagagatggctgggacatgccctccaagcccaagacagccagtgacgtgttc
ctgttggctgctttgcacgcagtacctcctggccgactcaccttattccgtgaagagtca
gcaaagggaggccagaagctgaaaacccctgcctttcgccctgcggccagcgggggcatg
gaaaaggagagtagggggctgactcttagaaagaaagaggtgggccagcatggtccaccc
acaggaggttccatgttacctgacgagggagtttcagcggattgtgttattacgtgcggt
tctaatcggatccctcttattcccttacaggtgggtacagacgcttccagcttgagaaag
gcagaccccaaaggtcggagcgctctgttggctgatatccagcagggaactcgcctacgg
aaagtcacacagatcaatgaccgcagtgccccacaaattgagagttctaagggaggcaac
aaagaaggaggaggttctgcaaactctcgaggcggaagcacacccccagccctgggagat
ctgtttgccggtggctttccagtgttgcgtccagcaggccagagggatgcagcaggtggc
aagacagggcaggcccctggctcccgggcgccttctccccggcttcctatcaaaactatc
agtggcccgctgaacccccctgcatctcccaggctaggcagtgcctctgaggtgcacggc
gctgccaggacagtccctcctcgccccagcatgcctgccccaccgcctcctaccccaccc
ccacctcctccacccctgcccccacccctgcccccttcctcccccaccaaaactccgctg
gtgtccccacctggcccacccaccaaagggaaccccccaggggctgtaccccctctcccc
tccgtacctccccctccccctcccccccctcccccaactccacccccccttcccctggcc
tccgttctcagtgacaaggcagtgaagcctcaactaacccccttgcacctaccacccatc
ccacccccactccccctcctcccaccttgtgggtatccagggctcagtgcagatgctacc
agccccgcccaggatgtgcgggagcctcccgccccaccgcccccgccacccccaccccct
ctttatgcctcctgtaccccgaggtcctctgtgcctgcgcctcctttgccaggagctaac
aacagcagtgaagccccgcccccgctgccccccaagtctcccagcttccaggcccagcca
cccaagtccagcgttcaagccttgcctacacctccagcccctccgggatcccagacgttc
gtgcagaagaggcccggacgaggcccagggaccagtgggggaaagctaaatccaccccca
gcaccgcctgcgaggtcacccaccacggagctttccagcagaagccagcaggccccagcc
tggaccccgacaccgcagccgggaggtcagctgtggaacggaagcctgcatatcatcgat
gactttgagtcgaaattcacgtttcatactgtggaagactttcctcctccagatgagtat
aaaccgagccagaagagttaccccagcaagatccccagaagccggacacctggtccctgg
ctccatgccgaggcggcagggcagagctcggatgacatcaaaggcagaaattctcagtta
tctctaaagacactccggtga

KEGG   Felis catus (domestic cat): 101096587Help
Entry
101096587         CDS       T02385                                 

Gene name
WIPF1
Definition
(RefSeq) LOW QUALITY PROTEIN: WAS/WASL-interacting protein family member 1
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101096587 (WIPF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101096587 (WIPF1)
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    101096587 (WIPF1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: WH2 CAP_N GRP
Motif
Other DBs
NCBI-GeneID: 101096587
NCBI-ProteinID: XP_023115243
Ensembl: ENSFCAG00000014400
Position
C1
AA seq 499 aa AA seqDB search
MPVPPPPAPPPPPTFALANTEKPTLNKSEQAGRNALLSDISKGKKLKKTVTNDRSAPILD
KPKGAGAGGSGGFGGGGGGGGGGGGSFGGGGPPGLGGLFQAGMPKLRSTANRESDSGGSR
LPVLPPGGRSTSAKPFSPPSGPGRFPVPSPGHRSGPPEPQRNRMPPPRPDVGAKPESIPP
PVPNTPRPIQSSLHNRGSPPVPGAPRQPSPGPTPPPFPGNRGAAFGGGSIRQTPSGSSSP
FSNRPPLPPTPSRALDDKPPPPPPPVGNRPSVHREAVPPPPPQNSKPPVPSTPRPSSSSQ
APPPPPPPSRPGPPPLPPGSSGSDETPRLPQRNLSLTSSSAPPLPSPGRSGPLPPPPNER
PPPPVRDPPGRSGPLPPPPPISRNGSTSRALPATPQLPSRSGVDSARSGPRPPLPPDRPG
AGAPPPPPPSTSIRNGFQDSSGEDEWESRFYFHPISDLPPPEPYVPTAKSYPSKLARSET
RSGSNRRERGAPPLPPIPR
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcctgtccctccccctccggcgcccccgcccccaccgacgtttgctctggccaataca
gaaaagcctaccttgaataagtccgaacaggctgggagaaatgcccttctgtctgacatc
agcaaagggaagaaactgaagaagactgtcaccaatgacagaagtgcaccgatattggac
aagcccaaaggcgctggtgctggtggcagtggtggctttggtggtggcggaggcggaggt
ggcggtggcggtggcagtttcggagggggtggaccgcctggtttgggaggactgttccag
gctgggatgccgaagctgagatccacagccaacagggagagtgattctggaggaagccga
ctcccagttttgccaccgggaggaagatccacatctgccaaacctttctcacccccaagt
ggcccagggagatttcctgtgccttccccaggccacagaagtggtcccccagagcctcag
aggaaccgaatgcctcccccaaggcccgacgtgggcgcaaagcctgaaagcattccccct
ccagtacctaatacgccaagacccattcaatcaagtctgcacaaccgagggtccccacca
gtgcctggggcccccaggcagcccagccctgggccaactcctccccctttccctggaaac
cgaggtgctgcttttggaggaggctccatacgccagacaccctcaggctcctcctcaccc
ttctccaacaggcctcccctgccccctacccccagcagggccttggatgacaaaccccct
cctccgcctcctccagtgggcaacaggccctccgtccacagggaggcagtcccaccccct
ccccctcagaacagcaagcccccagtgccttctaccccgaggccttcctcctcctcacag
gccccaccgccaccgccgccaccaagcagaccaggccctcctcccctgcctccgggttcc
agtggcagtgatgaaaccccaagactcccacagcggaatctgtcccttacttcttcatct
gcaccccccttaccttcaccaggacgttcgggccctcttcctcccccgcccaatgagaga
ccccctcctccagtgagggacccaccaggcagatcaggccctctcccaccaccccctcca
ataagcagaaatggcagcacatctcgggccctgcctgccaccccccagttgccgtccagg
agtggagtagatagtgccaggagtggacctaggcctcctcttcctcccgacaggcctggt
gctggggcacctccccctcctccaccatcaacatcaattagaaatggcttccaagactct
tcaggtgaagatgagtgggaaagcagattctacttccatccgatttctgatttgccacct
ccagagccatatgtaccaacggccaaaagttatcccagtaaactggcaagaagtgaaacc
cggagtggatccaaccgaagagaaaggggtgcccctccactccctcccatcccgaggtga

KEGG   Felis catus (domestic cat): 102899754Help
Entry
102899754         CDS       T02385                                 

Definition
(RefSeq) WAS/WASL-interacting protein family member 3-like
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    102899754
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    102899754
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    102899754
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 102899754
NCBI-ProteinID: XP_023110410
Position
B2
AA seq 491 aa AA seqDB search
MALVRRPGAPAFSRKGLQLGSWGLSVQLLERVFELVVQARSSDYSQQSGESGKACVRRRG
AVVPHLAADAWGSDPSIREQPEGTCTRTNTLTCTRTLICTRTGTRTCTRTGIRTNTLTCT
DTRTVTYTCTLTRTGTYTYTRTGTRTCTAAAGTSDVSAASGTSVCVTEAPGLDIYFSRKS
LPFRRLKDPPRPDPGAADIYFRLRGARPGFRWEGLCRLEGRGACGEGAAGAVQRPVWGLA
GAPFRSESRVQAGHRPLLQAGRPAYPPGRPFPPLLQAISPTPPVGPSALLQAVFPPPPGR
PPPPLPGELHSPCSRQAILSSSRQAAPLPSRQATPRPPGGPLPRCSRQATPSSSRRAAVC
PPPPPPRSRQATPSSGAPECIGCVARKTREPETFLFPPCRGPELLGITDHLSSELPACGA
VTSRTWGEGEGLGPGLLDPPHTVPVGEENCPPPAHPAGTRTRVWPQAGRPRTKAVCTRRG
PSADLPPLPSL
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcgctggtccgtcgacccggagcacctgccttcagcaggaagggtctgcagctggga
agctggggtctctcagtccagctgctggaaagggttttcgagcttgtggtccaggcccgg
agctcagattactcccagcaaagcggagaaagcgggaaagcctgcgtgcggaggcgtggc
gctgttgtcccccacctggcagcagacgcgtggggctcagatcccagcatccgggagcag
cccgagggcacctgcacccgcaccaacactctcacctgcacccgcaccctcatctgcacc
cgtacaggcacccgcacctgcacccgcacaggcatccgcaccaacactctcacctgcaca
gacacccgcactgttacttacacctgcaccctcacccgcacaggtacttacacctacacc
cgcacaggcacccgcacctgcacagctgctgcgggcacctctgacgtcagcgctgcctcc
ggcacaagcgtgtgcgtcacagaagcgcccggcctggacatctacttcagtagaaaatct
ctccccttccgcaggctgaaggacccacctcggccagacccgggggccgctgatatttac
ttccggctccgcggcgcgaggcccggcttccggtgggaggggctctgccggctggagggg
aggggagcctgcggggagggggcggccggagcggtgcagaggccggtttggggcctcgcc
ggcgcgcccttccgctccgaaagtcgcgtccaggcgggccaccgccccctcctccaggca
ggccgccccgcctaccctccaggaagacctttccccccacttctccaggccatctccccc
acccctcccgttggcccctccgccctgctccaggccgtctttccccctcctccaggcagg
ccaccccctcctcttccaggcgagctgcactccccctgctctaggcaggccatcctctcc
tcctccaggcaggctgcccccctaccttccaggcaggccacaccccgtcctccaggcggg
ccgctcccccgctgctccaggcaggccaccccctcctcctccaggcgggccgccgtctgc
cccccccccccccccccccgctccaggcaggccaccccctccagtggggctcccgagtgt
atcggttgtgtcgcacggaagacgcgtgaacccgagaccttcctgtttcccccgtgtcga
ggcccggagttacttggaattactgatcatctgtcttctgagctcccagcctgtggggct
gtgacgtcacggacgtggggggagggggagggcctgggcccgggtctcctcgaccctccc
cacacggtccccgtcggggaagagaactgcccgcctccagcacaccctgcaggaacgcgg
acgcgggtgtggccacaggctggccgaccccggaccaaagccgtctgcacccggaggggc
cccagcgctgacctcccccctctcccctcattgtaa

KEGG   Felis catus (domestic cat): 109491810Help
Entry
109491810         CDS       T02385                                 

Definition
(RefSeq) uncharacterized protein LOC109491810
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109491810
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    109491810
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    109491810
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 109491810
NCBI-ProteinID: XP_023105417
Position
D1
AA seq 372 aa AA seqDB search
MPACGFRGRPGSLRGKRKGNTGPMKQAKTLQAQKVEKNAISILSLHPEPGSRVCMPASVG
RGANAARTLCVHSVRVGQQPKLPPVSLPQLPADSGQGAGSPRKPSWWRPRARHRPSHHLP
SCSAALILWIPRLTLPPALHLPLLIPERGTERAPPRYKSSPVSCRCSGPGCRFGGVQRGG
PRGQQSLPETPPPPPTGRCQHVARAPLVQTRGSSHRLLRGRRTPPTSRGGDSGCTWARAP
SPASPHPPPPRREGRLLASRALPQTPDPSPASHLRSGGRNARLARPLATLGAIFTRRVQQ
SLNFRGEVPTEGSVAETELKLLGSEERTIGSAGWKEPQRFIDGKLQSLNSAHSRNNSLYP
LPSVGRDQEQHF
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcctgtggcttccggggccggcccggcagcctgcgaggaaagcggaaggggaac
accggccccatgaagcaagcgaaaaccctgcaggcccagaaggtggagaaaaatgcgatt
agcattttatctctgcaccccgagcctgggagccgcgtctgcatgcccgcctctgtggga
cgaggggcaaacgcagccaggaccttgtgtgtccactccgtcagggttgggcagcagcca
aagctgccaccagtctcccttccccagctgccggcggactctggacagggagccggcagc
cccaggaagccttcgtggtggagacccagagccagacaccggccctcacatcacctcccc
tcctgctcggctgccctcattctttggatccctaggctgacactcccgccggcccttcat
cttcccttactgatcccagaacgagggacggagcgagcacctccacgctacaaatccagc
cccgtgtcctgcagatgcagcggtcctggctgcaggtttgggggagtccagcggggaggc
ccccggggccagcagagcctcccagagacgccgccccccccccccactggccggtgccag
cacgtagcccgagccccgcttgtccagacccggggctcctcacaccgccttctcaggggc
agacgcacaccgcccacgtcccgtgggggtgactcgggctgtacttgggcccgggctccg
agcccagcatcgccccaccccccccccccgagaagagaagggaggctcttggcctccaga
gccctgccgcaaaccccggacccgagcccggcttcccatctacgaagcggaggaaggaac
gcccgcctggcgagaccgttggcaacactgggtgccatattcacgcgacgcgttcagcag
agtctgaacttccggggagaggtcccaacagaagggtctgtcgctgaaaccgagctcaaa
ttactgggctcagaggaaagaaccataggctctgctggctggaaggaaccccagaggttc
atcgatggcaagctccagtctctaaattcagctcactccagaaataacagcctctaccca
ctcccaagcgtgggaagagatcaggaacagcatttctga

KEGG   Felis catus (domestic cat): 109494088Help
Entry
109494088         CDS       T02385                                 

Definition
(RefSeq) CASP-like protein 4A2
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    109494088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    109494088
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    109494088
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 109494088
NCBI-ProteinID: XP_023099228
Position
E1
AA seq 323 aa AA seqDB search
MSDASLPRRSPRSPVSAPPRTRGGNSTSSGGGSHLKPPAPGSSCKNETPIRLAPQEDIDD
SPPPGRAAQFRAPGARSSLAKPRQSATSCPRSPPPSPGHGQRPAAALRGRSPPASGGRGE
ETPPQTGRQRKRGRNYCPKPPAGSADPPCSPSRAQPAASESGSGGASRAPSAEGGEPGTR
ARRGPAGSPRRARAFGPSAIFLGSPEPPLPRFHRPQLAPPPPPPPPRFSVSVPAAAAAAS
PRGSPAARRPGAEAGGRAGEPRLSAAIRRRRGLGVGAAGQRGGAWAPAARSPTRTGEFLI
SLERTSRPPLGRGRPGRDSAGAL
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgtccgatgcctcgctgccccggaggtctccccgatcgccggtctccgctcctcctcgc
acgagaggcggaaacagcactagcagcggcggcggcagccacctgaagccaccagcgccg
ggctcttcctgcaaaaacgagaccccgatccgcctggcgccccaagaagacatagacgat
agccccccgccgggccgcgctgcacagttccgggcccccggcgctcgcagctcgctggct
aagcccaggcagtccgcgacaagttgccctcgaagtccgcccccctcaccggggcatggt
cagaggccggctgccgcgctccggggccgctctcctcctgcttccggggggcggggggag
gagacgccaccgcagacagggagacagagaaagagaggcaggaattattgcccgaaaccg
ccggcaggctccgccgaccctccctgctccccaagtcgcgcgcagcccgctgcctccgag
tccggctcgggcggcgcatccagggcgccaagcgccgaaggcggggagccggggacccgg
gcgcgtcgggggcccgcgggctccccacgtcgcgcgcgcgctttcggtccctctgctatt
ttcctaggctccccggaacccccgttgcctcgcttccatcgcccgcaactagcgccgccg
ccgccgccgccgccgccgcgattttccgtgagcgtccccgccgccgccgccgccgccagc
ccccgcggcagccccgccgcccggcgcccgggggcggaggcaggaggccgggctggggag
cctaggcttagcgcggccataaggaggaggcgagggctgggcgtcggagccgcgggccag
cgcggaggcgcctgggccccggccgctcggtcgcccaccaggactggggagtttctcatc
tccttggaaagaacttcgcgcccgccgctggggcgcgggagacccgggcgggactcagcc
ggggcgctgtga

KEGG   Felis catus (domestic cat): 111558368Help
Entry
111558368         CDS       T02385                                 

Definition
(RefSeq) WAS/WASL-interacting protein family member 1-like
  KO
K19475  WAS/WASL-interacting protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    111558368
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    111558368
Membrane trafficking [BR:fca04131]
 Others
  Actin-binding proteins
   Nucleation-promoting factors (NPFs)
    111558368
BRITE hierarchy
SSDB OrthologParalogGFIT
Other DBs
NCBI-GeneID: 111558368
NCBI-ProteinID: XP_023103451
Position
F1
AA seq 364 aa AA seqDB search
MLLGPGNGRPPHCRLGACSSAPRKETLLSAGRGGGGGGGGGGGGNTPQPRERQARSRPLG
QGCRPPGMQCGRRHPHFRPAAPALQTQHVPGRGLAVPHTRGRGDRRRAPHAPLTSRPRCT
APPDRVPAPRQSPSHERSPRPRLGGTLLSGAARPTRSARVSAHGTRAGAQPAPRSPQKVG
AGPDGGHGPRQSGEMHLCAESCAGKRDTRPGFGLRQKIPAPVPVQLGPNLPTRDRESGPR
DTKFQNTCATLHGPRCCLAAAEATAVGTLPHTSPLTPGPPVTCSCAGSPPDLPPSHARSV
ASRTAGHGGTPLLCALTSGMETSQPPPYPEQRPGAANGPGRRNRGRVPHVQLGAKLQGVS
RTAR
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgctcctcggccccgggaatggacgtcctcctcattgccggctgggggcatgctcctcg
gcgccgagaaaggagacgctcctcagtgccggtcgcgggggggggggggggggggggggg
ggggggggggggaatacgcctcagccccgagaacgtcaggctcggagccgccctctcggc
cagggctgccgccctcccggcatgcagtgcggccgacggcacccacacttccggccggcg
gcccccgccctccagacgcagcacgtgccggggcggggcctagccgtgccacacacgcgg
ggacgcggggacaggcgccgcgctcctcacgcgccgctgacgtcgaggccacggtgcacc
gcgccccccgaccgcgtccccgccccgcgccagtcccccagccacgagagaagtcccagg
ccccgattagggggcacgctactttccggcgccgcgaggcccacccggtccgctcgtgtt
tccgcccacgggacccgggctggggcccaacccgccccgcgcagtcctcagaaagtgggt
gcgggccctgacggtggacatggccctcgccagtctggggaaatgcacttgtgtgcagag
tcttgtgctgggaaacgagacacccgcccgggattcggtcttcgccagaaaatccctgcc
ccggtcccggttcaacttggcccgaatcttccgacgcgggacagggagagcgggccgcgt
gacaccaaattccagaacacctgcgccacccttcacggcccgcggtgttgcctcgccgcc
gccgaagccactgccgtagggacgcttccgcacacgagccccctcacccccggtccacct
gtaacctgctcgtgtgccggcagccctcccgacctaccgccgtcccacgcacgcagtgtg
gcctcgagaacggccggccacgggggaaccccgctactgtgcgcgctcacgagcggaatg
gaaacgagccaaccccccccctacccggaacagaggccgggcgctgccaacgggccgggg
cggcggaaccggggacgggtcccacacgtccagctgggagccaaactccagggcgtctcc
cgcacagcacggtga

DBGET integrated database retrieval system