KEGG   Felis catus (domestic cat): 101082546Help
Entry
101082546         CDS       T02385                                 

Gene name
RPS6KA3
Definition
(RefSeq) ribosomal protein S6 kinase alpha-3 isoform X3
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04114  Oocyte meiosis
fca04150  mTOR signaling pathway
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04931  Insulin resistance
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082546 (RPS6KA3)
   04150 mTOR signaling pathway
    101082546 (RPS6KA3)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101082546 (RPS6KA3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101082546 (RPS6KA3)
  09156 Nervous system
   04720 Long-term potentiation
    101082546 (RPS6KA3)
   04722 Neurotrophin signaling pathway
    101082546 (RPS6KA3)
  09159 Environmental adaptation
   04714 Thermogenesis
    101082546 (RPS6KA3)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101082546 (RPS6KA3)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101082546 (RPS6KA3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101082546 (RPS6KA3)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101082546 (RPS6KA3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101082546 (RPS6KA3)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101082546 (RPS6KA3)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101082546 (RPS6KA3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Pkinase_C Haspin_kinase APH YrbL-PhoP_reg tRNA-synt_1f
Motif
Other DBs
NCBI-GeneID: 101082546
NCBI-ProteinID: XP_004000383
Ensembl: ENSFCAG00000010795
UniProt: A0A2I2U9Z1
Position
X
AA seq 740 aa AA seqDB search
MPLAQLADPWQKMAVESPSDSAENGQQIMDEPMGEEEINPQTEEGSIKEIAITHHVKEGH
EKADPSQFELLKVLGQGSFGKVFLVKKISGSDARQLYAMKVLKKATLKVRDRVRTKMERD
ILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAELALA
LDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKESIDHEKKAYSFCGTVEYMAPEVV
NRRGHTQSADWWSFGVLMFEMLTGTLPFQGKDRKETMTMILKAKLGMPQFLSPEAQSLLR
MLFKRNPANRLGAGPDGVEEIKRHSFFSTIDWNKLYRREIHPPFKPATGRPEDTFYFDPE
FTAKTPKDSPGIPPSANAHQLFRGFSFVAITSDDESQAMQTVGVHSIVQQLHRNSIQFTD
GYEVKEDIGVGSYSVCKRCIHKATNMEFAVKIIDKSKRDPTEEIEILLRYGQHPNIITLK
DVYDDGKYVYVVTELMKGGELLDKILRQKFFSEREASAVLFTITKTVEYLHAQGVVHRDL
KPSNILYVDESGNPESIRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGYDAACD
IWSLGVLLYTMLTGYTPFANGPDDTPEEILARIGSGKFSLSGGYWNSVSDTAKDLVSKML
HVDPHQRLTAALVLRHPWIVHWDQLPQYQLNRQDAPHLVKGAMAATYSALNRNQSPVLEP
VGRSTLAQRRGIKKITSTAL
NT seq 2223 nt NT seq  +upstreamnt  +downstreamnt
atgccgctggcgcagctggcggacccgtggcagaagatggctgtggagagcccgtccgac
agcgctgagaatggacagcaaattatggatgaacctatgggagaggaggagattaatcca
caaactgaagaaggcagtatcaaagaaattgcaatcacacatcatgtaaaggaaggacat
gaaaaggcagatccttcccaatttgaacttttaaaagtattgggacagggatcatttgga
aaggttttcttagtcaaaaaaatctcaggctctgatgctagacagctttatgccatgaaa
gtattgaagaaggccaccttgaaagttcgagaccgtgttcggacaaaaatggagcgtgat
atcttggtagaagttaatcatccttttattgtcaagttgcattatgcttttcaaactgaa
gggaagttgtatcttattttggattttctcaggggaggagatttgtttacacgcttatcc
aaagaggtgatgttcacagaagaagatgtcaaattctacttggccgaacttgcacttgct
ttagaccatctacatagcctgggaataatctatagagacttaaaaccagaaaacatactt
cttgatgaagaaggtcacatcaagttaacagattttggcctaagtaaagagtctattgac
catgaaaagaaggcatactctttttgtggaactgtggaatatatggctccagaagtagtt
aatcgtcgaggtcatactcagagtgcagactggtggtcttttggtgtgttaatgtttgaa
atgctcactggtacactacctttccaaggaaaagatcgaaaagaaacaatgactatgatt
cttaaagccaaacttgggatgccacagtttttgagtcctgaagcccagagtcttttgcga
atgcttttcaaacgaaatcctgcaaacagattaggtgcaggaccagatggagttgaggaa
attaaaagacactcatttttctcaacaatagactggaataaactgtacagaagagaaatt
catccaccttttaaacctgcaactggcagacctgaagatacattctattttgatcctgag
tttactgcaaaaactcccaaagactcacctggcattccacccagtgctaatgcacatcag
ctttttcgggggtttagttttgttgctatcacctcagatgatgaaagccaagctatgcag
acagttggtgtgcattcaattgtgcagcagttgcacagaaacagtattcagtttactgat
ggatatgaagtaaaagaagatattggcgttggctcctactctgtttgcaagagatgcata
cataaagctacaaacatggagtttgcagtgaagattattgataaaagcaagagagaccca
acagaagaaattgaaatacttcttcgttatggacagcatccaaacatcattactctaaag
gatgtatatgatgatggaaaatacgtgtatgtagtgacagaacttatgaaagggggtgaa
ttgctggataaaattcttagacagaaatttttctctgaaagagaggccagtgctgtcctc
tttactataaccaaaactgttgaatatcttcacgcacaaggggtggttcacagagacttg
aaacctagcaacattctttacgtggatgaatctggcaatccagaatctattcgaatttgt
gattttggctttgccaaacagctaagagcagaaaacggtcttctcatgactccttgttat
actgcaaattttgttgcaccagaggttttaaaacgacaaggctatgatgctgcttgtgat
atatggagtcttggtgtcctcctctatacaatgcttactggttacactccatttgcaaat
ggccctgatgatacaccagaggaaatattggcacggataggcagcgggaaattctcactc
agtggtggttactggaattctgtttcagacacagcaaaggacctggtgtcaaagatgctt
catgtggaccctcatcagagactgacggctgccctcgtgctcaggcatccttggattgtc
cactgggaccaactgccgcaataccaactaaatagacaggacgcgccccatctagtcaag
ggtgccatggcagctacgtattctgctttaaaccgtaatcagtcaccggttttggaacca
gtaggccgttctactcttgctcagcggagaggtattaaaaaaatcacctccacagccctg
tga

KEGG   Felis catus (domestic cat): 101086492Help
Entry
101086492         CDS       T02385                                 

Gene name
RPS6KA1
Definition
(RefSeq) ribosomal protein S6 kinase alpha-1 isoform X2
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04114  Oocyte meiosis
fca04150  mTOR signaling pathway
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04931  Insulin resistance
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101086492 (RPS6KA1)
   04150 mTOR signaling pathway
    101086492 (RPS6KA1)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101086492 (RPS6KA1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101086492 (RPS6KA1)
  09156 Nervous system
   04720 Long-term potentiation
    101086492 (RPS6KA1)
   04722 Neurotrophin signaling pathway
    101086492 (RPS6KA1)
  09159 Environmental adaptation
   04714 Thermogenesis
    101086492 (RPS6KA1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101086492 (RPS6KA1)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101086492 (RPS6KA1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101086492 (RPS6KA1)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101086492 (RPS6KA1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101086492 (RPS6KA1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101086492 (RPS6KA1)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101086492 (RPS6KA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_fungal Pkinase_C Haspin_kinase APH YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 101086492
NCBI-ProteinID: XP_003989739
Ensembl: ENSFCAG00000012813
UniProt: A0A2I2UPE2
Position
C1
AA seq 744 aa AA seqDB search
MEQDPKPPRLRLWALLPWLPRKQRPRISQTSLPAPGPGSGPRQDSDEGILKEISITHHVK
AGSEKADPSHFELLKVLGQGSFGKVFLVRKITRPDSGHLYAMKVLKKATLKVRDRVRTKM
ERDILADVNHPFVVKLHYAFQTEGKLYLILDFLRGGDLFTRLSKEVMFTEEDVKFYLAEL
ALGLDHLHSLGIIYRDLKPENILLDEEGHIKLTDFGLSKEAIDHEKKAYSFCGTVEYMAP
EVVNRQGHTHSADWWSYGVLMFEMLTGSLPFQGKDRKETMTLILKAKLGMPQFLSTEAQS
LLRALFKRNPANRLGSGPDGAEEIKRHVFYSTIDWNKLYRREIKPPFKPAVAQPDDTFYF
DTEFTSRTPKDSPGIPPSAGAHQLFRGFSFVATGLMEDDGKPRPTQAPLHSVVQQLHGKN
LVFSDGYVVKETIGVGSYSVCKRCVHKATNMEYAVKVIDKSKRDPSEEIEILLRYGQHPN
IITLKDVYDDGKHVYLVTELMRGGELLDKILRQKFFSEREASFVLHTISKTVEYLHSQGV
VHRDLKPSNILYVDESGNPECLRICDFGFAKQLRAENGLLMTPCYTANFVAPEVLKRQGY
DEGCDIWSLGILLYTMLAGYTPFANGPSDTPEEILSRIGSGRFTLSGGNWNTVSETAKDL
VSKMLHVDPHQRLTAKQVLQHPWITQKDKLPQSQLSHQDLQLVKGAMAATYSALNSNKPT
PQLKPIESSILAQRRVRKLPSTTL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atggagcaggatcccaagccgccccgcttgcggctctgggccctgctcccctggctgccc
aggaagcagcggcccaggatcagccagacctctctgcctgcccctggccctggctctggc
cccaggcaggactcggatgagggcatcctcaaggagatctccatcacgcaccacgtcaag
gctggctctgagaaggccgacccatcccattttgagctgctcaaggttctgggccaggga
tcctttggcaaagtcttcctggtgcggaagatcacccgacctgacagtgggcacctgtat
gccatgaaggtactaaagaaggcaacgctgaaagtgcgtgaccgtgttcggaccaagatg
gagagagacatcctagctgatgtaaaccacccgtttgtggtgaagctccactatgccttc
cagactgagggaaagctctatcttattctggacttcctgcgaggcggggacctcttcaca
cggctctctaaagaggttatgttcacagaggaggacgtgaagttttacctggctgagcta
gccttgggcctggaccacctgcacagcctgggcatcatttacagagacctcaaacctgaa
aacatccttctggatgaggagggccacatcaaactcaccgactttggcctgagcaaggag
gccattgaccatgagaagaaagcctattccttctgcgggacggtggagtacatggccccc
gaggtcgtcaaccgccagggccacacccacagtgcagactggtggtcctatggggtgttg
atgtttgagatgctgacgggctccctgcccttccaggggaaggaccggaaagagaccatg
acactgattctaaaggcgaagctaggcatgccccagtttctgagcacggaagcccagagc
ctcctgcgggccctgttcaagcggaatcctgccaaccgtctcggctccggccctgatggg
gcagaggaaatcaagcggcatgtcttctactctaccattgactggaataagctgtaccgt
cgcgagatcaagccgcccttcaagccagccgtggcacaacctgatgacaccttctacttt
gacactgaattcacgtcccgcacacccaaggactccccaggcatccctcccagcgctggc
gcccatcagctgttccgtggcttcagcttcgtggccactggcctgatggaggatgatggc
aagcctcggcccacgcaggcacccctgcactccgtggtacagcaactccatgggaagaac
ctggtttttagcgatggctacgtggtaaaggagacgatcggtgtggggtcctactccgtg
tgcaagcgctgtgtccataaggccaccaacatggagtatgctgtcaaggtcatcgacaag
agcaagcgggatccctcagaagagattgagattcttctgcggtatgggcagcaccccaac
atcatcactctgaaagatgtgtacgatgatggcaaacatgtgtacctggtgacagagctt
atgcggggcggggagctactggacaagatcctgcggcagaaattcttctcagagcgggag
gccagctttgtcctacacaccatcagcaagaccgtggagtacctgcactcccagggggtt
gttcatagggacctcaagcccagcaacatcctgtacgtggacgagtctgggaaccctgag
tgcctgcgcatctgtgactttggctttgccaagcagctgcgggctgagaacggactcctc
atgacaccttgctacactgccaactttgtggcacccgaggtgctgaaacgccagggctac
gatgaaggctgtgacatctggagcctgggcattctgctgtacaccatgctggcgggatac
actccatttgccaatggacccagtgacacaccagaggaaatcctgtcccggatcggcagt
gggaggttcaccctgagtgggggaaactggaacacagtttcagagacagccaaggacctg
gtgtccaagatgctgcatgtggacccccaccagcgcctcacagctaagcaggtgctgcag
cacccatggatcacccagaaagacaagctcccccagagccagctgtcccaccaagacctg
cagctcgtgaagggagccatggcagctacgtactctgctctcaacagcaacaagcccacc
ccccagctgaagcccatcgagtcctctattctggcccagcggcgggtgaggaagcttccg
tccaccaccctgtga

KEGG   Felis catus (domestic cat): 101094163Help
Entry
101094163         CDS       T02385                                 

Gene name
RPS6KA6
Definition
(RefSeq) ribosomal protein S6 kinase alpha-6
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04114  Oocyte meiosis
fca04150  mTOR signaling pathway
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04931  Insulin resistance
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101094163 (RPS6KA6)
   04150 mTOR signaling pathway
    101094163 (RPS6KA6)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101094163 (RPS6KA6)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101094163 (RPS6KA6)
  09156 Nervous system
   04720 Long-term potentiation
    101094163 (RPS6KA6)
   04722 Neurotrophin signaling pathway
    101094163 (RPS6KA6)
  09159 Environmental adaptation
   04714 Thermogenesis
    101094163 (RPS6KA6)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101094163 (RPS6KA6)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101094163 (RPS6KA6)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101094163 (RPS6KA6)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101094163 (RPS6KA6)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101094163 (RPS6KA6)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101094163 (RPS6KA6)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101094163 (RPS6KA6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Pkinase_fungal Kdo Pkinase_C Haspin_kinase YrbL-PhoP_reg APH Pox_ser-thr_kin
Motif
Other DBs
NCBI-GeneID: 101094163
NCBI-ProteinID: XP_023104792
Ensembl: ENSFCAG00000009130
Position
X
AA seq 744 aa AA seqDB search
MLPFTPQEELWNQEMEVFGGGASSGEVDGLKMVDEPMEEGEADSCQDEGIVKEIPITHHV
KEGYEKADPAQFELLKVLGQGSFGKVFLVRKKTGPDAGQLYAMKVLKKASLKVRDRVRTK
MERDILVEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDVFTRLSKEVLFTEEDVKFYLAE
LALALDHLHQLGIVYRDLKPENILLDEIGHIKLTDFGLSKESVDQEKKAYSFCGTVEYMA
PEVVNRRGHSQSADWWSYGVLMFEMLTGTLPFQGKDRNETMNMILKAKLGMPQFLSAEAQ
SLLRMLFKRNPANRLGSEGVEEIKRHLFFANVDWNKLYRREVQPPFKPASGKPDDTFCFD
PEFTAKTPKDSPGLPASANAHQLFKGFSFVATSIAEEYKITPVTSANVLPIVQINGNSGQ
FAELYELKEDIGVGSYSVCKRCIHTATNMEFAVKIIDKSKRDPSEEIEILMRYGQHPNII
TLKDVYDDGRYVYLVTDLMKGGELLDHILKKKCFSEREASDVLFVIIKTVDYLHCQGVVH
RDLKPSNILYMDESANADSIRICDFGFAKQLRGENGLLLTPCYTANFVAPEVLMQQGYDA
ACDIWSLGVLFYTMLAGYTPFANGPNDTPEEILLRIGNGKFSLSGGNWDNISDGAKDLLS
HMLHMDPHQRYTTEQVLKHSWITHRDQLLNDQPNRYDASHVIKGVVVTTCSALTHKTFQP
VLEPVAASNLAQRRSMKKRTSTGL
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgctaccgttcactcctcaggaggagctttggaaccaagaaatggaggtgttcggaggc
ggcgcaagcagcggcgaggtggatggtcttaaaatggttgatgagccaatggaagaggga
gaagcagattcttgccaagatgaaggaattgttaaagaaatccctattactcatcatgtt
aaggaagggtatgagaaagcagatcctgcacaatttgagttgctcaaagttcttggtcag
ggatcctttggaaaggtttttcttgttcgaaagaagactggtcctgatgctgggcagctc
tatgcaatgaaggtgttaaaaaaagcttctttaaaagttcgagacagagttcggacaaag
atggagagggatatactggtggaagtaaatcatccatttattgtcaaattacactatgcc
tttcagactgaagggaagctgtatttaatactagattttctcaggggaggagatgtcttt
acaagattatccaaagaggttctgtttacagaggaagatgtgaaattctaccttgcagaa
ctggcacttgctttggatcatctgcaccaattaggaattgtatatagagacctgaaacca
gaaaacattttgcttgatgaaataggacatatcaagttaacagattttggactcagcaag
gaatctgtagatcaagaaaagaaggcttactcattttgtggtacagtggagtacatggct
cctgaagtagtaaataggagaggccactcccaaagtgctgattggtggtcatatggtgta
cttatgtttgaaatgcttactggtactctgccatttcaaggtaaagacagaaatgagacc
atgaatatgatattaaaagcaaaactcggaatgcctcagtttcttagtgctgaagcacaa
agtctactaaggatgttattcaaaagaaatccagcaaatagattgggttcagaaggagtt
gaggaaatcaaaagacatcttttttttgcaaatgttgactggaataaattatatagaaga
gaagttcaacctcctttcaaaccggcttctggaaaaccagatgatactttttgttttgat
cctgagtttactgcaaaaacacctaaagattctcctggtttaccagctagtgctaatgct
catcaactcttcaaaggattcagctttgtggcaacttctattgcagaagaatataaaatc
actcctgttacaagtgcaaatgtgttaccaattgttcagataaatggaaattctggacaa
tttgctgaattatatgaactaaaagaagatattggtgttggctcctattctgtttgcaag
cgatgcatacatacagctacgaacatggaatttgcagtgaagatcattgacaaaagtaag
agagacccttcagaagaaattgaaatattgatgcgctatggacaacaccccaacattatt
actttaaaggatgtttatgatgatggtagatatgtttaccttgttacggatttgatgaaa
ggaggagaactacttgaccatattctcaaaaaaaagtgtttctcagaacgggaagctagt
gatgtactgtttgtaataattaagacagttgactatcttcattgtcaaggagttgttcat
cgtgatcttaaacctagtaatattttatatatggatgaatcggccaatgcagactccatt
aggatctgtgattttgggtttgcaaaacagcttcgtggagaaaatggacttcttttaact
ccatgctacactgcaaactttgtagcacctgaggttcttatgcaacagggctatgatgct
gcttgtgatatttggagcctaggtgtccttttttacaccatgctggctggctacactcca
tttgctaatggccccaatgatactcctgaagagatactgctacgtataggcaatggcaag
ttctctttgagtggtggaaactgggataatatttcagatggagcaaaggatttactctcc
catatgctacatatggacccacatcagcggtacactacagaacaagtattaaaacactca
tggataacccacagagatcagttactgaatgatcagccaaatagatatgatgcatcacat
gtcattaagggagtagtggtcaccacatgttctgccctgactcacaagacctttcaacca
gtccttgagcctgttgctgcttcaaacttagctcagcgacggagcatgaaaaaacgaaca
tcaactggcctataa

KEGG   Felis catus (domestic cat): 101099466Help
Entry
101099466         CDS       T02385                                 

Gene name
RPS6KA2
Definition
(RefSeq) ribosomal protein S6 kinase alpha-2 isoform X1
  KO
K04373  ribosomal protein S6 kinase alpha-1/2/3/6 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
fca04114  Oocyte meiosis
fca04150  mTOR signaling pathway
fca04714  Thermogenesis
fca04720  Long-term potentiation
fca04722  Neurotrophin signaling pathway
fca04914  Progesterone-mediated oocyte maturation
fca04931  Insulin resistance
fca05135  Yersinia infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101099466 (RPS6KA2)
   04150 mTOR signaling pathway
    101099466 (RPS6KA2)
 09140 Cellular Processes
  09143 Cell growth and death
   04114 Oocyte meiosis
    101099466 (RPS6KA2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    101099466 (RPS6KA2)
  09156 Nervous system
   04720 Long-term potentiation
    101099466 (RPS6KA2)
   04722 Neurotrophin signaling pathway
    101099466 (RPS6KA2)
  09159 Environmental adaptation
   04714 Thermogenesis
    101099466 (RPS6KA2)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04931 Insulin resistance
    101099466 (RPS6KA2)
  09171 Infectious disease: bacterial
   05135 Yersinia infection
    101099466 (RPS6KA2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101099466 (RPS6KA2)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101099466 (RPS6KA2)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101099466 (RPS6KA2)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: AGC group
  RSK family [OT]
   101099466 (RPS6KA2)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Stress granule specific factors
     101099466 (RPS6KA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo Pkinase_C Pkinase_fungal APH Haspin_kinase YrbL-PhoP_reg
Motif
Other DBs
NCBI-GeneID: 101099466
NCBI-ProteinID: XP_023110337
Position
B2
AA seq 758 aa AA seqDB search
MPIAQLLELWKKIEVEPMEIETPEEDLNLDSEPTVQDTVEEGKCDSALPGTKSAASLEEE
GTVKEIDISHHVKEGFEKADPSQFELLKVLGQGSYGKVFLVRKTKGSDTGQLYAMKVLKK
ATLKVRDRVRSKMERDILAEVNHPFIVKLHYAFQTEGKLYLILDFLRGGDLFSRLSKEVM
FTEEDVKFYLAELALALDHLHGLGIIYRDLKPENILLDEEGHIKITDFGLSKEAIDHDKR
AYSFCGTIEYMAPEVVNRRGHTQSADWWSFGVLMFEMLTGSLPFQGKDRKETMALILKAK
LGMPQFLSTEAQSLLRALFKRNPCNRLGAGLDGVEEIKRNPFFMTVDWNKLYRKEIKPPF
KPAVGRPEDTFHFDPEFTARTPTDSPGVPPSANAHHLFRGFSFVASSLVQEPSPQDLHKA
TVHPIVQQLHGNNVHFTDGYEIKEDIGVGSYSVCKRCVHKATEAEYAVKIIDKSKRDPSE
EIEILLRYGQHPNIITLKDVYDDGKFVYLVTELMRGGELLDRILRQRHFSEREASDVLCI
ITRTMDYLHSQGVVHRDLKPSNILYMDESGNPESIRICDFGFAKQLRAENGLLMTPCYTA
NFVAPEVLKRQGYDAACDIWSLGTLLYTMLAGFTPFANGPDDTPEEILARIGSGKYALSG
GNWDSVSDAAKDVVSKMLHVDPHQRLTAVQVLKHPWIVNREYLSQNQLSRQDAHLVKGAM
AATYFALNRTPQAPRLEPVLSSSLAQRRGMKRLTSTRL
NT seq 2277 nt NT seq  +upstreamnt  +downstreamnt
atgccgatcgcacagttgctggagctatggaagaagatcgaggtggagcccatggaaatc
gagacccccgaggaggatcttaacctggactcggagcccaccgtgcaagataccgtggaa
gaaggcaaatgtgactccgccttgcctgggaccaagtcggccgcgtcactagaggaggaa
ggcaccgtgaaggagatcgacatcagccaccatgtgaaggaagggtttgaaaaggccgac
ccttcccagtttgaactgctgaaagtcttaggacaaggatcctacggaaaggtgttcctg
gtgaggaagaccaaggggtctgacacgggacagctgtacgcgatgaaagtcctcaagaaa
gctactttgaaagttcgggaccgagtccgatcgaagatggaaagagacattttggcagaa
gtgaatcacccttttattgtgaagcttcattatgcctttcagacggaggggaagctctac
ctgatactggacttcctgcgaggaggggacctcttcagccggctctccaaagaggtgatg
ttcactgaggaggatgtcaagttctacctggctgagctggccttggcgttagaccacctg
cacggcctggggatcatctacagggacctgaagcccgagaacatcctgctggacgaagag
ggacacattaagatcacagatttcgggctgagtaaggaggccatcgaccacgataagaga
gcttactccttctgcgggaccatagagtacatggcacccgaggtggtgaaccggcgggga
cacacgcagagcgccgactggtggtccttcggtgtgctcatgttcgagatgctcacggga
tcgctgccgttccaggggaaggacaggaaggagaccatggccctcatcctcaaagccaag
ctgggcatgccacagttcctcagcaccgaagcccagagcctgctgagagccctcttcaaa
cggaacccgtgcaaccgtctgggtgctggcctcgacggggtagaggagatcaagcggaac
cccttcttcatgaccgtagactggaataagctgtaccggaaggagatcaagccgccgttc
aagccagcggtgggcaggcccgaggacaccttccactttgaccccgagttcacggcacgg
acgcccacagactcacctggcgtcccccccagcgccaacgctcatcatctgttcagagga
ttcagtttcgtggcctcgagtctggtccaggagccctcgccgcaagatctgcacaaagcc
acggtccaccccatcgtgcagcagttacacgggaacaacgtacacttcaccgacggctac
gagatcaaggaggacatcggggtgggctcctactccgtgtgcaagcgatgtgtgcataaa
gcgacggaggcagagtacgccgtgaagatcatcgataagagtaaaagagacccctcggaa
gagatcgagattctcctgagatacggacagcatccgaacatcatcacgctcaaagacgtc
tatgacgacggcaagttcgtgtacctggtgacggagctgatgcgtggcggggagctcctg
gaccgcatcctgcgacagcgacacttctcagagcgggaggccagcgacgtgctgtgcatc
atcaccaggaccatggattacctccactcgcagggggttgttcatcgagacctgaagccg
agtaacatactgtacatggacgagtctggaaaccctgagtccatccgcatctgcgacttc
gggttcgccaagcagcttcgagctgagaacgggctgttgatgacaccctgctacacggca
aactttgtcgcccccgaggtcctgaagcgacaaggctatgacgcagcgtgtgacatctgg
agtctggggaccctgctttacaccatgctggcaggatttaccccttttgcaaacggcccc
gatgacactcccgaggagattttggcgaggatcggcagtgggaaatacgccctttctggg
gggaactgggactccgtctctgatgcggcaaaggatgtcgtatccaagatgctccatgtg
gaccctcatcagcgcctgacggcagttcaagttctcaaacacccgtggatcgtgaacaga
gagtacctgtcccaaaaccagctcagcagacaggacgcccacctggtgaagggggctatg
gccgccacctactttgccctgaaccgaaccccgcaggcgccgcggctggagcccgtgctg
tcgtccagcctggcgcagcgcaggggcatgaagagactcacgtccacgaggctgtag

DBGET integrated database retrieval system