KEGG   Felis catus (domestic cat): 101082635Help
Entry
101082635         CDS       T02385                                 

Gene name
SLC25A5
Definition
(RefSeq) ADP/ATP translocase 2
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04217  Necroptosis
fca04218  Cellular senescence
fca05012  Parkinson disease
fca05016  Huntington disease
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101082635 (SLC25A5)
   04022 cGMP-PKG signaling pathway
    101082635 (SLC25A5)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082635 (SLC25A5)
   04218 Cellular senescence
    101082635 (SLC25A5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101082635 (SLC25A5)
   05016 Huntington disease
    101082635 (SLC25A5)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101082635 (SLC25A5)
   05164 Influenza A
    101082635 (SLC25A5)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101082635 (SLC25A5)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101082635 (SLC25A5)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101082635 (SLC25A5)
Transporters [BR:fca02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   101082635 (SLC25A5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 101082635
NCBI-ProteinID: XP_011277743
Ensembl: ENSFCAG00000007057
UniProt: M3VW78
Position
X
AA seq 298 aa AA seqDB search
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggacttcctggcgggtggagtggcggcggcc
atctccaagaccgcggtcgcgcccatcgagcgggtcaagctgctgctgcaggtgcagcat
gccagcaagcaaatcaccgcagataagcaatacaagggcatcatagactgcgtggttcgt
atccccaaggagcagggagtcctgtccttctggcgcggtaacctggccaatgtcatcaga
tacttccccacccaggccctcaacttcgccttcaaagataaatacaagcagatcttcctg
ggtggcgtggacaagagaacccagttttggcgctactttgcagggaatctggcatcgggt
ggcgccgctggggccacatccttgtgttttgtgtatcctctggattttgcccgtacccgt
ctagcggccgatgtgggcaaagccggagcggaaagggaattccgaggccttggtgactgc
ctggttaagatctacaaatctgatgggattaagggcctgtaccaaggctttaatgtgtct
gtgcagggcattatcatctaccgagctgcctacttcggtatctatgataccgcaaagggc
atgcttccggatcccaagaacactcacatcttcatcagctggatgatcgcacagtccgtc
acagcggttgccgggttgacttcctatccctttgacactgttcgtcgccgaatgatgatg
cagtcggggcgcaaaggaaccgacatcatgtacacaggcacgcttgactgctggaggaag
attgctcgtgacgaaggggccaaagcttttttcaagggggcgtggtccaatgttctcaga
ggcatgggtggtgccttcgtgcttgtcttgtatgatgaaatcaagaagttcacataa

KEGG   Felis catus (domestic cat): 101086294Help
Entry
101086294         CDS       T02385                                 

Gene name
SLC25A31
Definition
(RefSeq) ADP/ATP translocase 4
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04217  Necroptosis
fca04218  Cellular senescence
fca05012  Parkinson disease
fca05016  Huntington disease
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101086294 (SLC25A31)
   04022 cGMP-PKG signaling pathway
    101086294 (SLC25A31)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101086294 (SLC25A31)
   04218 Cellular senescence
    101086294 (SLC25A31)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101086294 (SLC25A31)
   05016 Huntington disease
    101086294 (SLC25A31)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101086294 (SLC25A31)
   05164 Influenza A
    101086294 (SLC25A31)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101086294 (SLC25A31)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101086294 (SLC25A31)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101086294 (SLC25A31)
Transporters [BR:fca02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   101086294 (SLC25A31)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 101086294
NCBI-ProteinID: XP_004001144
Ensembl: ENSFCAG00000007128
UniProt: M3W759
Position
B1
AA seq 323 aa AA seqDB search
MQREPPKGRQGKKSEKRLFDPVSFGKDLLAGGVAAAVSKTAVAPIERVKLLLQVQASSRQ
ISAESQYKGMVDCLVRIPREQGFFSYWRGNLANVIRYFPTQALNFAFKDKYKQLFMSGVN
KEKQFWRWFLANLASGGAAGATSLCVVYPLDFARTRLGADIGKGPEERQFKGLGDCIIKI
AKSDGIVGLYQGFGVSVQGIIVYRASYFGAYDTVKGLLPKPKETPFLVSFFIAQVVTTCS
GILSYPFDTVRRRMMMQSGEAERQYKGTLDCFVKIYQHEGINAFFRGAFSNILRGTGGAL
VLVLYDKIKELLNIDIGGSSSGD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgtgaacctccgaaggggaggcaggggaagaagtcggaaaagcggctctttgac
cccgtgtccttcgggaaggacctactggccggcggggtcgcagcggctgtgtccaagaca
gccgtggcgcccatcgagcgggtgaagctgctgctgcaggtgcaggcgtcgtcccgacag
atcagcgccgagtctcagtacaaaggcatggtggattgcctggtgcggattccccgcgag
cagggtttcttcagttattggcgtggcaatttggcaaatgttatccggtattttccaaca
caagctctaaactttgcttttaaggacaaatacaaacaacttttcatgtctggagttaat
aaagaaaaacagttctggaggtggtttttggcaaacctggcctctggtggagctgctgga
gcaacatccttatgtgtagtttatccattagactttgcccgaacccgattaggtgctgat
attggaaaaggtcctgaagagcggcaattcaagggtttaggtgactgtattataaaaata
gcaaaatcggatggaattgttggtttgtaccaagggtttggtgtttcagttcagggcatc
attgtgtaccgagcctcctattttggagcatatgacaccgttaagggcttattaccaaaa
ccaaaggaaaccccgtttcttgtctcctttttcattgctcaagttgtgaccacatgctct
ggaattctctcttatccctttgacacagttagaagacgcatgatgatgcagagtggtgag
gctgaacggcaatataaaggaactttagactgctttgtgaagatataccaacatgaagga
atcaatgcattttttcgtggtgccttctccaatatccttcgtggtacagggggtgctttg
gtgttagtactatatgataaaattaaagaactccttaatattgatattggaggtagttca
tcaggagattaa

KEGG   Felis catus (domestic cat): 101092793Help
Entry
101092793         CDS       T02385                                 

Gene name
VDAC2
Definition
(RefSeq) voltage-dependent anion-selective channel protein 2
  KO
K15040  voltage-dependent anion channel protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04216  Ferroptosis
fca04217  Necroptosis
fca04218  Cellular senescence
fca04621  NOD-like receptor signaling pathway
fca04979  Cholesterol metabolism
fca05012  Parkinson disease
fca05016  Huntington disease
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101092793 (VDAC2)
   04022 cGMP-PKG signaling pathway
    101092793 (VDAC2)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101092793 (VDAC2)
   04217 Necroptosis
    101092793 (VDAC2)
   04218 Cellular senescence
    101092793 (VDAC2)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101092793 (VDAC2)
  09154 Digestive system
   04979 Cholesterol metabolism
    101092793 (VDAC2)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101092793 (VDAC2)
   05016 Huntington disease
    101092793 (VDAC2)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101092793 (VDAC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101092793 (VDAC2)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101092793 (VDAC2)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    101092793 (VDAC2)
Ion channels [BR:fca04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   101092793 (VDAC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 101092793
NCBI-ProteinID: XP_011285609
Ensembl: ENSFCAG00000026943
UniProt: M3X2J1
Position
D2
AA seq 294 aa AA seqDB search
MATYGQSCARPMCIPPSYADLGKAARDIFNKGFGFGLVKLDVKTKSCSGVEFSTSGSSNT
DTGKVTGTLETKYKWCEYGLTFTEKWNTDNTLGTEIAIEDQICQGLKLTFDTTFSPNTGK
KSGKIKSSYKRECINLGCDVDFDFAGPAIHGSAVFGYEGWLAGYQMTFDSAKSKLTRNNF
AVGYRTGDFQLHTNVNDGTEFGGSIYQKVCEDLDTSVNLAWTSGTNCTRFGIAAKYQLDP
TASISAKVNNSSLIGVGYTQTLRPGVKLTLSALVDGKSINAGGHKLGLALELEA
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atggcgacctatggacagagctgcgcgcggccaatgtgtattcctccatcatatgctgac
cttggcaaagctgccagagatattttcaacaagggatttggttttgggttggtgaaactg
gatgtgaaaacaaagtcatgcagtggtgtggaattctcaacatctggttcatctaacaca
gacactggtaaagttactggaaccttggagaccaaatataaatggtgtgagtatggtctg
actttcacagaaaaatggaacactgataacactctgggaacagaaatagcaattgaagac
cagatttgtcaaggtttgaaactgacatttgatactaccttttcaccaaacacgggaaag
aaaagtggtaaaatcaagtcttcttacaagagggagtgtataaacctcggttgtgatgtt
gactttgattttgctggacctgcaatccatggttcagctgtctttggttatgagggctgg
cttgctgggtaccagatgacctttgacagtgccaaatcaaagctgacaagaaacaacttt
gcagtgggctacaggactggggatttccagctacacactaatgtcaatgatgggacagaa
tttggaggttcaatttatcagaaagtatgtgaagatcttgacacttcagtaaaccttgct
tggacatcaggtaccaactgcactcgctttggcattgcagccaaatatcagttggacccc
actgcttccatttctgcaaaagtcaacaactctagtttaattggagtgggctatactcag
actctgaggcctggtgtcaagcttacactgtctgctctggtagatgggaagagcattaat
gctggaggccacaaacttgggcttgccctggagttggaggcttaa

KEGG   Felis catus (domestic cat): 101096309Help
Entry
101096309         CDS       T02385                                 

Gene name
SLC25A4
Definition
(RefSeq) ADP/ATP translocase 1
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04217  Necroptosis
fca04218  Cellular senescence
fca05012  Parkinson disease
fca05016  Huntington disease
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101096309 (SLC25A4)
   04022 cGMP-PKG signaling pathway
    101096309 (SLC25A4)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101096309 (SLC25A4)
   04218 Cellular senescence
    101096309 (SLC25A4)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101096309 (SLC25A4)
   05016 Huntington disease
    101096309 (SLC25A4)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101096309 (SLC25A4)
   05164 Influenza A
    101096309 (SLC25A4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101096309 (SLC25A4)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101096309 (SLC25A4)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101096309 (SLC25A4)
Transporters [BR:fca02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   101096309 (SLC25A4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 101096309
NCBI-ProteinID: XP_023108091
Position
B1
AA seq 298 aa AA seqDB search
MTDHALSFLKDFLAGGVAAAVSKTAVAPIERVKLLLQVQHASKQISAEKQYKGIIDCVVR
IPKEQGFLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDRHKQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKGAAQREFSGLGDCLTKIFKSDGLKGLYQGFSVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNVHIIVSWMIAQSVTAVAGLVSYPFDTVRRRMMM
QSGRKGADIMYTGTVDCWRKIAKDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKYV
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgactgatcacgccttgagcttcctgaaggatttcctggccggcggcgtcgccgctgcc
gtgtccaagaccgcggtcgccccaatcgagagggtcaaactgctgctgcaggtccagcat
gccagcaaacagatcagtgctgagaagcagtacaaagggatcattgattgtgtggtgaga
atccccaaggagcagggctttctctccttctggaggggtaacctggccaatgtgatccgt
tacttccccacccaagctctcaacttcgccttcaaggacaagtacaagcagatcttcctg
gggggcgtcgaccggcataagcaattctggcgctactttgccggtaacctggcttccggt
ggggcagctggggccacctccctctgctttgtctacccactggactttgctaggaccagg
ttggctgccgacgtgggcaagggtgctgcccagcgtgagttcagtggtctgggcgactgt
ctcaccaagatcttcaagtctgatggcctgaagggtctctaccagggtttcagcgtctct
gtccagggcatcattatctacagagctgcctactttggagtttatgatactgccaagggg
atgttgcctgaccccaagaatgtgcacattattgtgagctggatgattgcccagagcgtg
acagcggtcgcagggctggtgtcctacccctttgacactgtccgccgtaggatgatgatg
cagtctggccggaaaggggcggatattatgtacactgggacggtggactgctggaggaag
attgcaaaagatgagggagccaaggctttcttcaaaggtgcctggtccaatgtgttgaga
ggcatgggcggagctttcgtattggtattgtatgatgagatcaaaaaatacgtctaa

KEGG   Felis catus (domestic cat): 101098515Help
Entry
101098515         CDS       T02385                                 

Gene name
VDAC1
Definition
(RefSeq) voltage-dependent anion-selective channel protein 1
  KO
K05862  voltage-dependent anion channel protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04217  Necroptosis
fca04218  Cellular senescence
fca04621  NOD-like receptor signaling pathway
fca04979  Cholesterol metabolism
fca05012  Parkinson disease
fca05016  Huntington disease
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101098515 (VDAC1)
   04022 cGMP-PKG signaling pathway
    101098515 (VDAC1)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101098515 (VDAC1)
   04218 Cellular senescence
    101098515 (VDAC1)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101098515 (VDAC1)
  09154 Digestive system
   04979 Cholesterol metabolism
    101098515 (VDAC1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101098515 (VDAC1)
   05016 Huntington disease
    101098515 (VDAC1)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101098515 (VDAC1)
   05164 Influenza A
    101098515 (VDAC1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101098515 (VDAC1)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101098515 (VDAC1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    101098515 (VDAC1)
Ion channels [BR:fca04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   101098515 (VDAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 101098515
NCBI-ProteinID: XP_023110926
Ensembl: ENSFCAG00000008421
Position
A1
AA seq 283 aa AA seqDB search
MAVPPTYADLGKCARDVFTKGYGFGLIKLDLKTKSENGLEFTSSGSANTETTKVTGSLET
KYRWTEYGLTFTEKWNTDNTLGTEITVEDQLARGLKLTFDSSFSPNTGKKNAKIKTGYKR
EHINLGCDVDFDIAGPSIRGALVLGYEGWLAGYQMNFETAKSRVTQSNFAVGYKTDEFQL
HTNVNDGTEFGGSIYQKVNKKLETAVNLAWTAGNSNTRFGIAAKYQIDPDACFSAKVNNS
SLIGLGYTQTLKPGIKLTLSALLDGKNVNAGGHKLGLGLEFQA
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
atggctgtgcctcccacgtatgctgatcttggcaaatgtgccagggatgtcttcaccaag
ggttatggatttggcttaatcaaactcgatttgaagacaaaatctgagaatggactggaa
tttacgagctcaggttctgccaacactgagaccaccaaagtgacgggcagtctggaaacc
aagtacagatggactgaatacggtctgacgtttacggagaaatggaacactgacaacaca
ttaggcacagagattactgtggaggatcagcttgcacgtggactgaagctgacctttgat
tcatccttctcaccaaacacagggaaaaaaaatgctaaaatcaagacagggtataagcgg
gagcacatcaacctgggctgtgacgtggatttcgacatcgccggcccttcgatccggggc
gctctggtgctgggctatgagggctggctggctggctaccagatgaattttgagaccgca
aagtctcgagtgacccagagcaactttgcagttggctacaagactgacgaattccagctc
cacactaatgtaaacgatgggacagagtttggtggctccatttatcagaaggtgaacaag
aagttagagaccgctgttaatctggcctggacagcaggaaatagtaacactcgctttgga
atagcggccaagtatcagatcgatcctgacgcctgcttctcggctaaagtgaacaactcc
agcctgataggtttaggatacactcagaccctaaagccaggtatcaaactgacgctctca
gctttgctggatggcaagaatgtcaatgctggtggccacaagcttggtctaggactggaa
tttcaggcataa

KEGG   Felis catus (domestic cat): 101099117Help
Entry
101099117         CDS       T02385                                 

Gene name
VDAC3
Definition
(RefSeq) voltage-dependent anion-selective channel protein 3 isoform X1
  KO
K15041  voltage-dependent anion channel protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04216  Ferroptosis
fca04217  Necroptosis
fca04218  Cellular senescence
fca04621  NOD-like receptor signaling pathway
fca04979  Cholesterol metabolism
fca05012  Parkinson disease
fca05016  Huntington disease
fca05161  Hepatitis B
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101099117 (VDAC3)
   04022 cGMP-PKG signaling pathway
    101099117 (VDAC3)
 09140 Cellular Processes
  09143 Cell growth and death
   04216 Ferroptosis
    101099117 (VDAC3)
   04217 Necroptosis
    101099117 (VDAC3)
   04218 Cellular senescence
    101099117 (VDAC3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101099117 (VDAC3)
  09154 Digestive system
   04979 Cholesterol metabolism
    101099117 (VDAC3)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101099117 (VDAC3)
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101099117 (VDAC3)
   05016 Huntington disease
    101099117 (VDAC3)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101099117 (VDAC3)
   05161 Hepatitis B
    101099117 (VDAC3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101099117 (VDAC3)
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:fca04040]
    101099117 (VDAC3)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial protein import machinery
  Outer membrane
   Porin
    101099117 (VDAC3)
Ion channels [BR:fca04040]
 Chloride channels
  Maxi chloride channel (VDAC)
   101099117 (VDAC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Porin_3
Motif
Other DBs
NCBI-GeneID: 101099117
NCBI-ProteinID: XP_023108333
Ensembl: ENSFCAG00000010075
Position
B1
AA seq 284 aa AA seqDB search
MCNTPTYCDLGKAAKDVFNKGYGFGMVKIDLRTKSCSGVMEFSTSGHAYTDTGKASGNLE
TKYKVCNYGLTFTQKWNTDNTLGTEISLENKLAEGLKLTLDTIFVPNTGKKSGKLKASYK
RECFSLGSNVDIDFSGPTIYGWAVLAFEGWLAGYQMSFDTAKSKLSQNNFALGYKAADFQ
LHTHVNDGTEFGGSIYQKVNEKIETSINLAWTAGSNNTRFGIAAKYKLDCRTSLSAKVNN
ASLIGLGYTQTLRPGVKLTLSALIDGKNFNAGGHKVGLGFELEA
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtgtaacacaccaacttactgtgacctaggaaaggccgccaaggatgtcttcaacaaa
ggatacggatttggcatggtcaaaatagacctgagaaccaagtcttgtagtggagtgatg
gaattttctacttctggtcatgcttacactgatacaggaaaagcgtcaggcaacctagag
accaaatataaggtctgtaactatggacttaccttcactcagaaatggaacacagataac
actcttggaacagaaatctctttggagaataagttggctgaagggttgaaactgactctt
gataccatatttgtaccgaacacaggaaagaagagtggaaaattgaaggcctcctataag
cgggaatgtttcagtctcggcagcaatgttgatatagatttttctggaccaaccatctat
ggctgggctgtgttagcctttgaaggttggcttgctggctatcagatgagtttcgacaca
gccaaatccaaactgtcacagaataatttcgctctgggttacaaggccgcagacttccag
ctgcacactcatgtgaatgacggcactgaatttggagggtctatctaccagaaggttaat
gagaagattgaaacatcaataaaccttgcttggacggctggcagtaacaatacccgtttt
ggcatcgctgctaaatacaagctggactgtagaacttctctatctgctaaagtaaataat
gccagcctgattggactgggttatactcagactcttcgaccaggagtcaaactgacccta
tcagctttaatcgacggaaagaacttcaatgcaggaggtcacaaggttgggttgggattt
gagctagaagcttaa

KEGG   Felis catus (domestic cat): 101099589Help
Entry
101099589         CDS       T02385                                 

Gene name
PPIF
Definition
(RefSeq) peptidyl-prolyl cis-trans isomerase F, mitochondrial isoform X5
  KO
K09565  peptidyl-prolyl isomerase F (cyclophilin D) [EC:5.2.1.8]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca05012  Parkinson disease
fca05016  Huntington disease
fca05145  Toxoplasmosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101099589 (PPIF)
   04022 cGMP-PKG signaling pathway
    101099589 (PPIF)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101099589 (PPIF)
   05016 Huntington disease
    101099589 (PPIF)
  09174 Infectious disease: parasitic
   05145 Toxoplasmosis
    101099589 (PPIF)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:fca03110]
    101099589 (PPIF)
Enzymes [BR:fca01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     101099589 (PPIF)
Chaperones and folding catalysts [BR:fca03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Cyclophilin
    101099589 (PPIF)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pro_isomerase
Motif
Other DBs
NCBI-GeneID: 101099589
NCBI-ProteinID: XP_003994158
Ensembl: ENSFCAG00000025543
UniProt: M3XFI8
Position
D2
AA seq 204 aa AA seqDB search
MLALRCGPRLLGLLRVPRSAPLRLPAARACSGAGDPSPSSRNPLVYLDVGADGEPLGRVV
LELKADVVPKTAENFRALCTGEKGFGYKGSTFHRVIPSFMCQAGDFTNHNGTGGKSIYGS
RFPDENFTLKHVGPGVLSMANAGPNTNGSQFFICTIKTDWLDGKHVVFGHVKEGMDVVKK
IESFGSRSGKTSKKIVITDCGQLS
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgcttgctctacgctgcggcccccgcctgctcggcctgctccgggtcccgcgctccgcg
ccgctgcgcctccccgcggcccgcgcctgcagcggcgccggcgacccgtccccttcctcc
cggaacccgctcgtgtacctggacgtgggcgccgacggggagccgctcggccgcgtggtg
ctggagctgaaggcagatgtcgtcccgaagacagcagagaacttcagagccctgtgtacc
ggggagaagggcttcggctacaaaggctccacctttcacagagtgattccgtccttcatg
tgccaggcgggcgacttcaccaaccacaatggcaccgggggaaagtccatctacggaagc
cgctttcctgatgagaacttcacactgaagcacgtgggaccaggtgtcctctccatggcg
aatgcaggccccaacaccaacggctcccagttcttcatctgcaccataaagacagactgg
ttggatggcaagcatgttgtgtttggccatgtcaaagagggcatggatgtcgtgaagaaa
atagaatctttcggttccaggagtgggaagacgtccaagaagatcgtcatcacagactgc
ggccagttgagctga

KEGG   Felis catus (domestic cat): 101100868Help
Entry
101100868         CDS       T02385                                 

Gene name
SLC25A6
Definition
(RefSeq) ADP/ATP translocase 3
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04217  Necroptosis
fca04218  Cellular senescence
fca05012  Parkinson disease
fca05016  Huntington disease
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    101100868 (SLC25A6)
   04022 cGMP-PKG signaling pathway
    101100868 (SLC25A6)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101100868 (SLC25A6)
   04218 Cellular senescence
    101100868 (SLC25A6)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    101100868 (SLC25A6)
   05016 Huntington disease
    101100868 (SLC25A6)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101100868 (SLC25A6)
   05164 Influenza A
    101100868 (SLC25A6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    101100868 (SLC25A6)
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101100868 (SLC25A6)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    101100868 (SLC25A6)
Transporters [BR:fca02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   101100868 (SLC25A6)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr Fuseless
Motif
Other DBs
NCBI-GeneID: 101100868
NCBI-ProteinID: XP_023104656
Ensembl: ENSFCAG00000001211
Position
X
AA seq 298 aa AA seqDB search
MTEQAISFAKDFLAGGIAAAISKTAVAPIERVKLLLQVQHASKQIAADKQYKGIVDCIVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKHTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKSGTEREFKGLGDCLVKITKSDGIRGLYQGFNVS
VQGIIIYRAAYFGVYDTAKGMLPDPKNTHIVVSWMIAQTVTAVAGVVSYPFDTVRRRMMM
QSGRKGADIMYKGTLDCWRKIFKDEGGKAFFKGAWSNVLRGMGGAFVLVLYDELKKVL
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacggaacaggccatctctttcgccaaggacttcctggccggaggcatcgccgccgcc
atctccaagacggcggtggccccgatcgagcgggttaagctgctgctgcaggtgcagcac
gccagcaagcagatcgccgccgacaagcagtacaagggcatcgtggactgcatcgtgcgc
atccccaaggagcagggcgtcctgtccttctggaggggcaacctggccaacgtcatccgc
tacttccccacgcaagcgctcaacttcgccttcaaggataagtacaagcagatcttcctg
gggggcgtggacaagcacacgcagttctggaggtacttcgccggcaacctggcgtcgggc
ggggcggccggagccacgtcgctgtgcttcgtgtacccgctggatttcgccaggacccgt
ctggccgccgacgtgggcaagtcgggcaccgagcgggagttcaagggcctgggagactgc
ctggtcaagatcaccaagtctgacggcatccggggcctgtaccagggcttcaacgtgtcg
gtgcagggcatcatcatctaccgggcggcctacttcggcgtgtacgacacggccaagggc
atgctcccggaccccaagaacacgcacatcgtggtgagctggatgatcgcgcagacggtg
acggctgtggcgggcgtggtctcctaccccttcgacaccgtgcggaggcgcatgatgatg
cagtcggggcgcaaaggagccgacatcatgtacaaggggaccctcgactgctggcggaag
atcttcaaagacgaagggggcaaagccttcttcaagggtgcgtggtccaacgtcctgcgg
ggcatggggggcgcctttgtgctcgtgctgtatgatgagctgaagaaagtcctctag

KEGG   Felis catus (domestic cat): 111558717Help
Entry
111558717         CDS       T02385                                 

Definition
(RefSeq) ADP/ATP translocase 2
  KO
K05863  solute carrier family 25 (mitochondrial adenine nucleotide translocator), member 4/5/6/31
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04217  Necroptosis
fca04218  Cellular senescence
fca05012  Parkinson disease
fca05016  Huntington disease
fca05164  Influenza A
fca05166  Human T-cell leukemia virus 1 infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    111558717
   04022 cGMP-PKG signaling pathway
    111558717
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    111558717
   04218 Cellular senescence
    111558717
 09160 Human Diseases
  09164 Neurodegenerative disease
   05012 Parkinson disease
    111558717
   05016 Huntington disease
    111558717
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    111558717
   05164 Influenza A
    111558717
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:fca03029]
    111558717
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    111558717
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    111558717
Transporters [BR:fca02000]
 Solute Carrier Family (SLC)
  SLC25: Mitochondrial carrier
   111558717
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Mito_carr
Motif
Other DBs
NCBI-GeneID: 111558717
NCBI-ProteinID: XP_023104892
Position
X
AA seq 298 aa AA seqDB search
MTDAAVSFAKDFLAGGVAAAISKTAVAPIERVKLLLQVQHASKQITADKQYKGIIDCVVR
IPKEQGVLSFWRGNLANVIRYFPTQALNFAFKDKYKQIFLGGVDKRTQFWRYFAGNLASG
GAAGATSLCFVYPLDFARTRLAADVGKAGAEREFRGLGDCLVKIYKSDGIKGLYQGFNVS
VQGIIIYRAAYFGIYDTAKGMLPDPKNTHIFISWMIAQSVTAVAGLTSYPFDTVRRRMMM
QSGRKGTDIMYTGTLDCWRKIARDEGAKAFFKGAWSNVLRGMGGAFVLVLYDEIKKFT
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacagatgccgctgtgtccttcgccaaggacttcctggcgggtggagtggcggcggcc
atctccaagaccgcggtcgcgcccatcgagcgggtcaagctgctgctgcaggtgcagcat
gccagcaagcaaatcaccgcagataagcaatacaagggcatcatagactgcgtggttcgt
atccccaaggagcagggagtcctgtccttctggcgcggtaacctggccaatgtcatcaga
tacttccccacccaggccctcaacttcgccttcaaagataaatacaagcagatcttcctg
ggtggcgtggacaagagaacccagttttggcgctactttgcagggaatctggcatcgggt
ggcgccgctggggccacatccttgtgttttgtgtatcctctggattttgcccgtacccgt
ctagcggccgatgtgggcaaagccggagcggaaagggaattccgaggccttggtgactgc
ctggttaagatctacaaatctgatgggattaagggcctgtaccaaggctttaatgtgtct
gtgcagggcattatcatctaccgagctgcctacttcggtatctatgataccgcaaagggc
atgcttccggatcccaagaacactcacatcttcatcagctggatgatcgcacagtccgtc
acagcggttgccgggttgacttcctatccctttgacactgttcgtcgccgaatgatgatg
cagtcggggcgcaaaggaaccgacatcatgtacacaggcacgcttgactgctggaggaag
attgctcgtgacgaaggggccaaagcttttttcaagggggcgtggtccaatgttctcaga
ggcatgggtggtgccttcgtgcttgtcttgtatgatgaaatcaagaagttcacataa

DBGET integrated database retrieval system