KEGG   Felis catus (domestic cat): 101082662Help
Entry
101082662         CDS       T02385                                 

Gene name
AQP9
Definition
(RefSeq) aquaporin-9
  KO
K09877  aquaporin-9
Organism
fca  Felis catus (domestic cat)
Pathway
fca04976  Bile secretion
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09154 Digestive system
   04976 Bile secretion
    101082662 (AQP9)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fca02000]
    101082662 (AQP9)
Transporters [BR:fca02000]
 Other Transporters
  Aquaporins and small neutral solute transporters [TC:1.A.8]
   Aquaglyceroporins or glycerol-uptake facilitators
    101082662 (AQP9)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MIP
Motif
Other DBs
NCBI-GeneID: 101082662
NCBI-ProteinID: XP_003987153
UniProt: M3XBC1
Position
B3
AA seq 295 aa AA seqDB search
MQPGKGRKGKSFKQRLVLKSTLAKETISEFLGTFIMIVLGCGSVAQAILSRGHLGGIVTI
NVGFAMAVVMAIYVTGGVSGGHINPAVSFAMCLFGRMKWFKFPFYVGAQFLGAFVGAAAL
FGIYYDGLMSFAGGKLLIVGENATAHIFATYPAPYLSLTNAFADQVVATMFLLMIVFAIF
DSRNLGVPKGLEPIAIGLLIIVISSSLGLNSGCAMNPARDLSPRLFTALAGWGFEVFTAG
NNFWWIPVVGPLVGAVIGGLIYVLVIEIHHPDPDPDFETEQTEDKTDKYELSVIM
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgcagcctgggaaaggacgaaaggggaagagcttcaagcaaagactggtcttgaagagc
accttagctaaagaaacaatctctgagttcttgggcacctttataatgatcgtccttgga
tgtggctctgttgcccaagctatcctcagtcgtggacacttgggaggaattgtcactatc
aatgttggatttgcaatggcagttgtaatggccatttatgtgactggaggtgtctctggt
ggccacatcaacccagctgtgtcttttgcaatgtgtctctttggacggatgaaatggttc
aaatttcctttttatgtgggagcccagtttttgggagcctttgtaggagctgcagccctc
tttggcatttactatgatggacttatgtcctttgctggtggaaaattgctcatcgtggga
gaaaatgcaacagcacacatttttgcgacatacccagctccatatctgtccctgacaaat
gcatttgcagaccaagtagtggccaccatgttcctcctcatgattgtctttgccattttt
gactccagaaatttgggagtccccaaaggcctagaacccattgccatcggcctcctgatt
attgtcatttcttcctccttgggattgaacagtggttgtgccatgaacccagctcgagac
ctgagtcccaggcttttcactgctttggcaggatgggggtttgaggtcttcacagctgga
aataacttctggtggattcctgtagtgggccctttggttggcgctgtcattggaggcctc
atctatgtgcttgtcattgaaatccaccacccagaccctgacccagacttcgagacagaa
caaactgaagacaaaacagataaatatgaacttagtgtgataatgtag

DBGET integrated database retrieval system