KEGG   Felis catus (domestic cat): 101082699Help
Entry
101082699         CDS       T02385                                 

Gene name
MAPKAPK5
Definition
(RefSeq) MAP kinase-activated protein kinase 5 isoform X2
  KO
K04442  mitogen-activated protein kinase-activated protein kinase 5 [EC:2.7.11.1]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082699 (MAPKAPK5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101082699 (MAPKAPK5)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101082699 (MAPKAPK5)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   101082699 (MAPKAPK5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kdo Kinase-like
Motif
Other DBs
NCBI-GeneID: 101082699
NCBI-ProteinID: XP_003994724
Ensembl: ENSFCAG00000025333
Position
D3
AA seq 471 aa AA seqDB search
MSEENDMEKAIKETSILEEYNINWTQKLGAGISGPVRVCVKKSTQERFALKILFDRPKAR
NEVRLHMMCATHPNIVQIIEVFANSVQFPHESSPRARLLIVMEMMEGGELFHRISQHRHF
TEKQASQVTKQIALALQHCHLLNIAHRDLKPENLLFKDNSLDAPVKLCDFGFAKIDQGDL
MTPQFTPYYVAPQVLEAQRRHQKEKSGIIPTSPTPYTYNKSCDLWSLGVIIYVMLCGYPP
FYSKHHSRTIPKDMRRKIMTGSFEFPEEEWSQISEMAKDVVRKLLKVKPEERLTIEGVLD
HPWLNSTEALDNVLPSAQLMMDKAVVAGIQQAHAEQLANMRIQDLKVSLKPLHSVNNPIL
RKRKLLGTKPKDGVYIHDRENGAEDSNVALEKLRDVIAQCILPQAGENEDEKLNEVMQEA
WKYNRECKLLRDTLQSFSWNGRGFTDKVDRLKLAEIVKQVIEEQTMSHESQ
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtccgaggagaacgacatggagaaagccatcaaggaaacctccattttagaggaatac
aatatcaattggactcagaagctgggagctggaattagtggtccagttagagtctgtgtg
aagaaatctactcaagaacggtttgcactgaaaattctttttgatcgtccaaaagctaga
aatgaggtacgtctgcacatgatgtgtgccacacacccaaatatagttcaaattattgaa
gtgtttgctaacagtgtacagtttcctcatgagtccagccccagggctcgactcttaatt
gtaatggagatgatggaagggggagagctatttcacagaatcagccagcaccggcacttt
acagagaagcaagccagccaagtaacaaagcagatagctttggctctacagcactgtcac
ctgttaaacattgctcacagagacctcaagcctgaaaatctgctcttcaaggataactct
ttggatgccccagtgaagttgtgtgactttgggtttgccaaaattgaccaaggtgacttg
atgacaccccaattcaccccttattatgtagcacctcaggtactggaggcgcagagaagg
catcagaaggagaaatctggcatcatacctacctcaccaacaccctacacttacaacaag
agctgtgacctgtggtccctaggggtgattatctacgtgatgttatgtggataccctcct
ttttactccaaacaccacagccggactatcccaaaggatatgcggagaaagatcatgaca
ggcagttttgagttcccagaagaagagtggagccagatctcggagatggccaaagatgtt
gtgaggaagctcttaaaggtcaaaccagaggaaagactcaccatcgagggcgtgttggac
cacccatggctcaactcgacagaggccttggataatgtgctaccctctgctcaactgatg
atggataaggcggtggttgcaggaatccagcaggctcatgcagaacagttggccaacatg
agaatccaggatctgaaagtcagcctcaaacccctgcactctgtgaacaaccctattctg
agaaaaaggaaattactcggcaccaagccaaaggacggtgtttatatccacgaccgtgaa
aatggagccgaggattcaaatgttgccttggaaaagctccgagatgtgattgctcagtgt
attctcccccaggctggagagaatgaagatgaaaagctgaatgaagtaatgcaggaggct
tggaagtataaccgggaatgcaaactcctaagagatactctgcaaagcttcagttggaat
ggtcgtggattcacagataaagtggatcgactaaaactggcagaaattgtgaagcaagtg
atagaagaacaaaccatgtcccatgaatcccaataa

DBGET integrated database retrieval system