KEGG   Felis catus (domestic cat): 101082724
Entry
101082724         CDS       T02385                                 

Gene name
AHRR
Definition
(RefSeq) LOW QUALITY PROTEIN: aryl hydrocarbon receptor repressor
  KO
K09094  aryl hydrocarbon receptor repressor
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101082724 (AHRR)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101082724 (AHRR)
SSDB
Motif
Pfam: PAS HLH PAS_3 PAS_4
Other DBs
NCBI-GeneID: 101082724
NCBI-ProteinID: XP_023095789
Ensembl: ENSFCAG00000015430
Position
A1
AA seq 713 aa
MMIPPGECMYAGRKRRKPIQKQRPATGAEKSNPSKRHRDRLNAELDHLASLLPLPPDIVS
KLDKLSVLRLSVSYLRVKSFFEAVQKCPRQPAAGTPSPEDSGLSGGSTVLEGRLLLESLD
GFALVVSAEGMIFYASATIVDYXGFHQTDVMHQNIYDYIHVDDRQDFCRQLHWAMDPPQA
VFGQPLHSDTEDAVLGRLLRAQEADFSAFLTRCFVCRVRCLLDSTSGFLTMQFQGKLKFL
FGQKRKTPSGTVLPPRLSLFCIVVPVLLPSVAEMKMKSAFLRVKHRVDVSGSVDTKAKAA
SSLCDPASHGKPHCLAGRGIGENISALKAQADAGCWARVPARAPCPCLRSSPDLVSGPEG
AAGDRGGEEHGGVSGSTPGARGRRERPAYSCCFEAPGPVRHLNWMTGKHGPDGGTNVKLG
PSKSDPFSTHTVSRGSCVSCPGVQGTVHSSGVTAFRNSPGRHPGSHSPSAYASRTSGALQ
DGCKGPPLPSCPFPQGSLDNGLPPPRGQRLAAGGYSTEDAKFRGGPVPTGAPCNPMLSLD
VPVKLENDSGSEDAADGYLVSPGQVWLGAGGVAKRQLVTFPTRIHLKTESDSRPHLYAPH
LGHSMLGAHLSGRAPLRPGKEPAPLRPAHCACLQHVRGLPEPDPPRHLCAHGHQPPTLGC
DCRAPGTTPVVKREPLDSPPWASHSQGGVPGMFPRSALPTLMPPKAPECAFLP
NT seq 2142 nt   +upstreamnt  +downstreamnt
atgatgattccaccaggggagtgcatgtatgctggaaggaaaagaaggaagcccattcag
aaacagaggccggccacgggggctgagaagtcaaacccgtccaagcggcaccgggaccgc
ctcaacgccgagctggaccacctggccagcctgcttccgcttcctcctgacatcgtgtct
aagctggacaagctttccgtcctgcgtctcagcgtcagctacctcagggtgaagagcttc
tttgaagccgtgcagaagtgcccacggcagccggcggctggtaccccctcaccagaagac
agcggtctgagcggagggtccaccgtgctggagggaaggctgctgctggagtctctcgat
ggctttgccctggttgtgagtgcagaaggcatgatattttacgcgtcagcaacgatcgtg
gactatnctggcttccaccagacggacgtgatgcaccagaacatctatgactatatccac
gtggatgaccgccaggacttctgccggcagctgcactgggccatggaccctccccaggcg
gtgtttgggcagcccctgcactcagacacagaggacgcggtgctggggcggctgctccgg
gcgcaggaggcggacttctcggccttcctgacgcgctgcttcgtgtgccgcgtgcgctgc
ctgctggacagcacctcgggcttcctgacaatgcagtttcaaggaaaactaaaattcctg
tttggacagaagaggaagactccatcagggacggtcctgccccctcggctgtcactgttc
tgcatcgtggtgcccgtcctccttccttccgtggcggagatgaaaatgaagagtgcgttt
ctgagagtgaagcacagggtggacgtctcaggctcagtggacacgaaagcaaaagccgcc
tcgagtctgtgtgacccagcatcgcatggaaaaccccactgcctggcagggaggggcatt
ggagaaaacatttcagcgctcaaggcacaagcggatgcaggctgctgggcccgggttcca
gccagagccccatgtccctgcctcaggagcagcccggacctcgtttctggccccgagggg
gccgccggggacaggggaggagaggagcacgggggggtgtctggcagcactcccggagcc
agggggcggagggaaagacctgcgtatagttgctgctttgaggcgcctggacccgtgagg
cacctgaactggatgacagggaaacatggtccagatggtggcaccaacgtgaagctggga
cccagtaagagtgacccgttctccacacacaccgtgtcccgtggctcctgcgtgtcctgc
cccggtgttcagggcactgtccatagcagtggggttactgctttccggaattcacccggc
cgtcacccaggaagccactctcccagtgcctatgccagccgcacgagcggagccttgcag
gacggctgcaaggggccccctctgcccagctgcccctttccccaggggagcctggacaat
gggctccctccgcccagaggacagcgtctcgcagcggggggctattccaccgaggacgcc
aagtttcgaggggggccggtgcccacgggagccccgtgcaaccccatgctgtcacttgat
gtgcccgtcaagctggagaacgactctgggtctgaggacgcggcagacggctacctcgtg
tccccaggccaggtgtggctgggagccggcggtgtggccaagaggcagctggtcactttc
cctaccaggatacacctgaagacagagtcagactccagaccccacctgtatgctccgcac
ctggggcacagcatgctgggggctcacctgagcggcagggctccactcagacccggcaag
gagccggcgcccttacgccccgcacactgtgcctgcctgcagcacgtgcgtggccttccc
gagccagatcctccccgccacctctgtgcacacggtcaccagccccctacactgggctgt
gactgcagagctcccggcaccacgcccgttgtcaagcgcgagcccctggactcaccccca
tgggcaagccacagccagggtggggtgcccggcatgttccccagaagtgccttgccaaca
ctgatgccccccaaagcccccgagtgtgctttcctgccgtag

DBGET integrated database retrieval system