KEGG   Felis catus (domestic cat): 101082829Help
Entry
101082829         CDS       T02385                                 

Gene name
PLA2G4D
Definition
(RefSeq) cytosolic phospholipase A2 delta
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca00590  Arachidonic acid metabolism
fca00591  Linoleic acid metabolism
fca00592  alpha-Linolenic acid metabolism
fca01100  Metabolic pathways
fca04010  MAPK signaling pathway
fca04014  Ras signaling pathway
fca04072  Phospholipase D signaling pathway
fca04217  Necroptosis
fca04270  Vascular smooth muscle contraction
fca04370  VEGF signaling pathway
fca04611  Platelet activation
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04726  Serotonergic synapse
fca04730  Long-term depression
fca04750  Inflammatory mediator regulation of TRP channels
fca04912  GnRH signaling pathway
fca04913  Ovarian steroidogenesis
fca04921  Oxytocin signaling pathway
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101082829 (PLA2G4D)
   00565 Ether lipid metabolism
    101082829 (PLA2G4D)
   00590 Arachidonic acid metabolism
    101082829 (PLA2G4D)
   00591 Linoleic acid metabolism
    101082829 (PLA2G4D)
   00592 alpha-Linolenic acid metabolism
    101082829 (PLA2G4D)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101082829 (PLA2G4D)
   04010 MAPK signaling pathway
    101082829 (PLA2G4D)
   04370 VEGF signaling pathway
    101082829 (PLA2G4D)
   04072 Phospholipase D signaling pathway
    101082829 (PLA2G4D)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101082829 (PLA2G4D)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101082829 (PLA2G4D)
   04664 Fc epsilon RI signaling pathway
    101082829 (PLA2G4D)
   04666 Fc gamma R-mediated phagocytosis
    101082829 (PLA2G4D)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101082829 (PLA2G4D)
   04913 Ovarian steroidogenesis
    101082829 (PLA2G4D)
   04921 Oxytocin signaling pathway
    101082829 (PLA2G4D)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101082829 (PLA2G4D)
  09156 Nervous system
   04724 Glutamatergic synapse
    101082829 (PLA2G4D)
   04726 Serotonergic synapse
    101082829 (PLA2G4D)
   04730 Long-term depression
    101082829 (PLA2G4D)
  09157 Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101082829 (PLA2G4D)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101082829 (PLA2G4D)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     101082829 (PLA2G4D)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cPLA2_C2 PLA2_B C2 YscJ_FliF
Motif
Other DBs
NCBI-GeneID: 101082829
NCBI-ProteinID: XP_011281374
Ensembl: ENSFCAG00000007353
UniProt: A0A2I2U0T3
Position
B3
AA seq 814 aa AA seqDB search
MERLTTRGPPGHPHQVEASACWRLTVKVLEARNLGWADLLSEADPYVTLQLPTAPGTKFK
TKTITNSSHPVWNETFSFLIQSRVKNILELNVYDEDPVTEDDACFKILYDVSEVLPGQLL
QKTFSLRPQGQEELDVEFLMEKTSERPENLITNNVLVARELSCLDVHLVSIGSTATVTDQ
DELELVLKGSYEDTQTSALGTASFRFHYMAAQEAELSGHLKRLERNAWTSDKSAEHLTVP
LRSLAMGKEVTINVPATNAPEVRLQLKTEGCPKELAMHLGFDLCAEEKAFLSRRKQVVAK
ALKQVLQLDRDLQEDEVPVVGIMATGGGARAMTSLYGHLLALQKLGLLDCVTYFSGISGS
TWTMAHLYGDPEWSQGDLKGPIKCAREHLAKSKLEAFSPERLASYCRELELRAKQGHPKT
FVDLWALVLESMLHGQVMDQKLSEQRAALERGQNPLPLYLSLNVKENHLETLDFKEWVEF
SPYEVGFLKYGAFVPSDLFGSEFFMGRLMRKLPESRICFLEGIWSNVLSLNLLDAWYDLI
SSDDTWKQHVKDKIKNLEESPASVRTSSRLEASWLQPGTTLAKVFKGFLTGRPLHQHSFN
FLRGLQLHQDYYSQRDFSTWADCELDSTPGQLTPQEPQLCLVDGGYFLNTSCPSMFRPGR
RLDLILSFDYSLSSPFKTLQQTELYCRARGLPFPRVDPNPQDQHQPTECHLFSDPTHPDT
PVLLHFPLVNASFKDHSAPGVLRSPTELPAGQVDLTGTASPYSLFNMTYKEEDFDRLLQL
SDYNVRNSQDAILQALRMAVKHRALGARPPTAQN
NT seq 2445 nt NT seq  +upstreamnt  +downstreamnt
atggaaagactgacaactaggggaccacctggccatcctcaccaggtggaggcctctgct
tgctggcggcttactgtgaaggtcctggaggccaggaacctgggctgggctgacctgttg
agtgaggcagacccctacgtgaccctacagctgcccactgcacctgggacaaagtttaaa
accaaaacaatcaccaactctagtcatcctgtatggaatgagaccttcagtttcctgatc
cagagtcgggtcaagaatattctggagctaaacgtctatgatgaggacccagtcacggag
gatgatgcctgcttcaagattctctatgatgtctcagaagtcctccctggccagctgctc
cagaagaccttctccctgcgtccccagggacaggaggagctggacgtggagttcctgatg
gaaaaaacgtcagaacgcccagaaaacctcatcaccaacaacgtccttgtggcccgagag
ctgtcatgcctggatgtccatctggtcagcattgggagcacagccacggtcacagatcag
gatgagctggagttggtgctgaagggctcatatgaagacacacagacctctgcactaggc
acagcatccttccgcttccactacatggcagcccaagaggcagaactgagtgggcatctg
aagaggttggaaaggaatgcctggacttcagacaagtcagctgagcacctcactgtgcct
ctaaggtccttggccatgggaaaggaggtgaccattaacgttcctgctacaaacgcccca
gaagtgaggctgcagctcaagactgagggctgccctaaggaactggctatgcacctgggc
tttgatctgtgtgcagaggagaaagctttcctgagcaggaggaagcaggtggtggccaag
gctctcaagcaggtcttgcagctggacagagacctacaggaggatgaggtccctgttgtg
ggcataatggccacaggaggaggtgcccgggccatgacgtctctctacggccacctgttg
gccctacagaagctgggcctcctggactgtgtgacctacttcagtggcatctcaggctct
acatggacaatggcccacctctacggggacccggagtggtcacagggggacctcaaagga
cccatcaaatgtgctagagagcacctggccaagagcaaactggaggccttctccccagag
cgcctagcaagctactgccgggagctggagctgcgggctaagcagggccaccccaagacc
tttgtggacctgtgggctctcgtgctggagtccatgctgcatggccaggtgatggatcag
aagctgtcggaacagagagctgcactggagcggggccagaaccctctgcccctctacttg
agcctcaacgtcaaagagaaccatctggagaccctggacttcaaggagtgggtagagttt
tcaccctatgaggtggggttcctgaagtatggagcctttgtgccttctgatctctttggc
tctgagttcttcatggggcggctgatgaggaagctccctgagtcccggatctgctttctg
gaaggtatctggagcaacgttttgtccctgaacttgctggatgcctggtatgacctcatc
agctctgatgacacctggaagcagcatgtcaaggacaaaattaagaacctggaggagtct
cctgcctccgtgaggacctcctcacggctggaggcttcctggctgcaacccggaacaacg
ctggccaaggtatttaagggcttcctgacaggcaggccgctccaccagcatagcttcaac
ttccttcggggcctccagctgcaccaggactactatagccagagagacttctccacctgg
gcagactgtgagctagactccacccctggtcagcttacgcctcaggagccacagctctgc
ctggtagatggcggctacttcctcaacaccagctgtccctccatgttccggccaggccgc
agactggacctcatactctccttcgactactccctatcctcaccctttaagacgctgcag
cagactgagctgtactgccgggcccggggcctgccattccctcgcgtggaccccaaccct
caggaccaacaccagccaacagagtgccacctcttctcggaccccactcaccctgatacc
cctgtcctgctgcacttcccactggtcaatgcctccttcaaggaccactcagcccctggt
gtcctacgcagccccacagagctcccagctggccaggtggatctcactgggaccgcctca
ccctattccctattcaacatgacctacaaggaggaagattttgatcgcctgctgcagctt
agtgactacaatgtacggaacagccaggatgccattctgcaggccttgaggatggccgtg
aaacaccgggccctgggggccaggcctccaacagcacagaattga

DBGET integrated database retrieval system