KEGG   Felis catus (domestic cat): 101082846Help
Entry
101082846         CDS       T02385                                 

Gene name
NCEH1
Definition
(RefSeq) neutral cholesterol ester hydrolase 1
  KO
K14349  neutral cholesterol ester hydrolase 1 [EC:3.1.1.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04927  Cortisol synthesis and secretion
fca04934  Cushing syndrome
fca04976  Bile secretion
fca04979  Cholesterol metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 09150 Organismal Systems
  09152 Endocrine system
   04927 Cortisol synthesis and secretion
    101082846 (NCEH1)
  09154 Digestive system
   04976 Bile secretion
    101082846 (NCEH1)
   04979 Cholesterol metabolism
    101082846 (NCEH1)
 09160 Human Diseases
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101082846 (NCEH1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101082846 (NCEH1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.-  
     101082846 (NCEH1)
Peptidases and inhibitors [BR:fca01002]
 Serine peptidases
  Family S9: prolyl oligopeptidase family
   101082846 (NCEH1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_3 COesterase Peptidase_S9 Say1_Mug180 AXE1
Motif
Other DBs
NCBI-GeneID: 101082846
NCBI-ProteinID: XP_003991951
Ensembl: ENSFCAG00000028457
UniProt: M3WQJ7
Position
C2
AA seq 408 aa AA seqDB search
MRSSCVLLTALVALAAYYIYIPLPSSVSDPWKLMLLDATFRSAQQVSNLIHYLGLSHHLL
ALNFIIVSFGKKSAWSSPQVKVTDTDFDGVEVRVFEGSPKPEEPLKRSVVYIHGGGWALA
SAKIRYYDELCTAMAEELNAVIVSIEYRLVPKVYFPAQIHDVVRATKYFLQPEVLHKYSV
DPGRIGISGDSAGGNLAAALGQQFTQDANLKNKLKVQALIYPVLQALDFNTPSYQQNVNT
PILPRYVMVKYWVDYFKGDYDFVQAMIVNNHTSMDVEEAVALRARLNWTSLLPASITKGY
KPVVQTTGNARILREIPQLLDARSAPLIADQEVLRHLPKTYILTCEHDVLRDDGIMYAKR
LESAGVEVTLDHFEDGFHGCMIFTSWPTNFSVGIRTRNSYIKWLDQNL
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgaggtcgtcctgtgtcctgctcaccgccctggtggcgctggccgcctattacatctac
atccccctgcccagctccgtgtccgatccctggaagctgatgctgctggacgcgactttc
cggagcgcacagcaagtgagcaacctgatccactacctgggcctgagccatcatctgctc
gcactgaattttatcatcgtttcttttggcaagaaaagcgcctggtcgtctcctcaggtg
aaggtgaccgatactgactttgatggtgtggaggtcagagtgtttgagggctccccaaag
ccagaagagcctttgaaacgcagcgttgtttacatccatggaggaggctgggctttagcc
agtgcaaaaatcaggtattatgatgaactgtgcacagcaatggctgaagaattgaatgct
gtcattgtctccattgaatacaggctagttccaaaggtttattttcctgcacaaattcat
gatgttgtacgtgccacgaagtattttctgcagccagaagtcttacacaagtattcggtt
gacccgggcagaattggcatttctggtgacagtgctggtgggaatttggccgctgctctg
ggccaacagtttactcaagatgccaacctcaaaaacaagctcaaagtgcaagctttaatt
tatccagttcttcaagctttggatttcaacacgccctcttaccagcaaaacgtgaacacc
ccaatcctgccccgctacgtcatggtgaagtactgggtggactacttcaaaggcgactat
gactttgtccaggcgatgattgttaacaaccacacttcgatggacgtggaagaggcagtt
gccctcagggcccgtctaaactggacgtccctcttgcctgcatccatcacaaagggctac
aagcctgtggtgcagaccaccggcaacgccaggattctgagggagatccctcagctgttg
gatgctcgctcggccccactcattgcagaccaggaagtcctccggcacctcccgaagacc
tatattctgacgtgtgagcatgatgtcctaagagacgatgggatcatgtatgcaaagcgt
ctggagagcgcaggtgtggaggtgaccctggatcactttgaggatggcttccatggatgc
atgattttcaccagctggcccaccaacttctcagtgggaatccggactaggaatagttac
atcaagtggctggatcaaaacctgtga

DBGET integrated database retrieval system