KEGG   Felis catus (domestic cat): 101082912Help
Entry
101082912         CDS       T02385                                 

Gene name
MAP3K5
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase 5 isoform X1
  KO
K04426  mitogen-activated protein kinase kinase kinase 5 [EC:2.7.11.25]
Organism
fca  Felis catus (domestic cat)
Pathway
fca01524  Platinum drug resistance
fca04010  MAPK signaling pathway
fca04071  Sphingolipid signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04530  Tight junction
fca04668  TNF signaling pathway
fca04714  Thermogenesis
fca04722  Neurotrophin signaling pathway
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05014  Amyotrophic lateral sclerosis (ALS)
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101082912 (MAP3K5)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101082912 (MAP3K5)
   04668 TNF signaling pathway
    101082912 (MAP3K5)
   04071 Sphingolipid signaling pathway
    101082912 (MAP3K5)
 09140 Cellular Processes
  09143 Cell growth and death
   04210 Apoptosis
    101082912 (MAP3K5)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101082912 (MAP3K5)
 09150 Organismal Systems
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101082912 (MAP3K5)
  09159 Environmental adaptation
   04714 Thermogenesis
    101082912 (MAP3K5)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05014 Amyotrophic lateral sclerosis (ALS)
    101082912 (MAP3K5)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101082912 (MAP3K5)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101082912 (MAP3K5)
  09176 Drug resistance: antineoplastic
   01524 Platinum drug resistance
    101082912 (MAP3K5)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101082912 (MAP3K5)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.25  mitogen-activated protein kinase kinase kinase
     101082912 (MAP3K5)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: STE group
  STE11 family
   101082912 (MAP3K5)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4071 Pkinase Pkinase_Tyr FPP Pkinase_fungal Kinase-like
Motif
Other DBs
NCBI-GeneID: 101082912
NCBI-ProteinID: XP_023110192
Ensembl: ENSFCAG00000008186
Position
B2
AA seq 1367 aa AA seqDB search
MSTEAGEGITFSVPPFAEGGSCRRGAAAAAAEGEESQLPPPPPGSFWNVESAAAPGTGCP
AATSGSSATRCRGNSGGGGGRRTTVAYVINEASQGQLVMAESEALQSLREACETVGATLE
TVHFGKLDFGETAVLDRFYNADIAVVEMSDAFRQPSLFYHLGVRESFSMANNIILYCDNN
SDSLQSLKEIICQKNTMCTGNYTFVPYMITPHNKVYCCDSSFMKGLTELMQPNFELLLGP
ICLPLVDRFIQLLKVAQASSSQYFRESILNDIRKARNLYTGKELAAELARIRQRVDNIEV
LTADIVINLLLSYRDIQDYDSIVKLVETLEKLPTFDLASHHHVKFHYAFALNRRNLPGDR
AKALDIMIPLVQSEGQVASDMYCLVGRIYKDMFLDSNFLDTESRDYGASWFKKAFESEPS
LQSGINYAVLLLAAGHQFESSFELRKVGVKLSSLLGKKGNLEKLQSYWEVGFFLGASVLA
NDHMRVIQASEKLFKLKTPAWYLKSIVETILIYKHFVKLTTEQPVAKQELVDFWMDFLVE
ATKTDVTVVRFPVLILEPTKIYQPSYLSINNEVEEKTISIWHVLPDDKKGIHEWNFSASS
VRGVSISKFEERCCFLYVLHNSDDFQIYFCTELHCKKFFEMVNTITEEKGRSTEEGDCEG
DSLEYDYEYDENGDRVVLGKGTYGIVYAGRDLSNQVRIAIKEIPERDSRYSQPLHEEIAL
HKHLKHKNIVQYLGSFSENGFIKIFMEQVPGGSLSALLRSKWGPLKDNEQTIGFYTKQIL
EGLKYLHDNQIVHRDIKGDNVLINTYSGVLKISDFGTSKRLAGINPCTETFTGTLQYMAP
EIIDKGPRGYGKAADIWSLGCTIIEMATGKPPFYELGEPQAAMFKVGMFKVHPEIPESMS
AEAKAFILKCFEPDPDKRACANDLLIDEFLKVSSKKKKTQPKLSALSAGSNAEYLRSISL
PVPVLVEDTSSSSEYGSVSPDTELKVDPFSFKTRAKSCGERDVKGIRTLFLGIPDENFED
HSAPPSPEEKDSGFFMLRKDSERRATLHRILTEDQDKVVRNLMESLAQGAEEPKLKWEHI
TTLIASLREFVRSTDRKIIATTLSKLKLELDFDSHGISQVQVVLFGFQDAVNKVLRNHNI
KPHWMFALDSIIRKAVQTAITILVPELRPHFSLASESDTADQEDLDAEDEREEQPSNQTV
QRPHAVIEDAVATSGVSTLSSTVSHDSQNAHRSLNVQLGRMKIETNRLLEELVQKEKELQ
ALLHQAIEEKDHEIKHLKLKSQPIDIPGVPVCHRDSLGTNAEESELAEWLREKGADEDTI
SRFLAEDYSLEDVLYYVTRDDLKCLRLRGGILCTLWKAITDFRDKQT
NT seq 4104 nt NT seq  +upstreamnt  +downstreamnt
atgagcacggaggcgggcgagggcatcactttctccgtgccacccttcgccgagggcggc
agctgccggaggggagcagcggcggcggcggccgagggcgaggagagccagctaccaccg
ccgccgccgggcagcttctggaacgtggagagtgccgccgccccgggcaccgggtgtccc
gctgccacctctgggagcagcgccacccggtgccggggcaactctggtggcggaggcggc
cgacggaccacggtggcatatgtgatcaacgaagcgagccaggggcagctggtgatggcc
gagagcgaggccctgcagagcctgcgggaggcgtgcgagacggtgggcgccaccctggag
accgtgcattttggtaaactggactttggggaaaccgcggtgctggatcgtttctacaat
gcagatatcgctgtggtggagatgagtgacgccttccgacagccatcattgttttaccac
cttggggtcagagaaagtttcagcatggccaacaacatcatcctctactgtgataataat
tcagactctctgcagtccctgaaggaaatcatttgccagaagaatactatgtgcactggg
aactacacattcgttccttacatgatcactccacataataaagtctactgctgcgatagc
agcttcatgaaggggttgacagagctcatgcaaccgaacttcgagctgcttcttggaccc
atttgcttacctcttgtggaccgtttcattcaacttctgaaggtagcacaagcaagttcc
agccagtatttccgggaatctatactcaatgatatcaggaaagctcgtaatttatacact
ggtaaagaattggcagctgaattggcaagaattcggcagcgagtagataatattgaagtc
ttgacagcagatattgtcataaacctgttactttcctacagagatatccaggactatgat
tctattgtgaagctggtagagacgttagaaaagctgccaacctttgatttggcttcccat
caccatgtgaagtttcattatgcatttgcactgaataggagaaatctccctggagacaga
gcaaaagctcttgatattatgattcccctggtgcaaagtgaagggcaagttgcttcagat
atgtattgcctagtgggccgaatctacaaagatatgtttttggactctaatttcctggac
actgaaagtagagactatggagcttcttggttcaaaaaggcatttgaatctgagccatca
ctacagtcaggaattaattatgcggtccttctcctggcagctgggcaccagtttgaatct
tcctttgagctccggaaagttggggtgaagctaagtagccttcttggtaaaaagggaaat
ttagaaaaactccagagctactgggaagttggattttttctcggtgccagtgtcctggcc
aatgaccacatgagagtcatccaagcatctgaaaagctttttaaactgaagacgccagca
tggtacctcaagtctattgtagagacaattttgatatataagcattttgtgaaactgact
acagagcagcctgtggccaaacaggagctggtggacttctggatggatttcctggtggag
gccacaaagacagatgttaccgtagttaggtttccggtgttaatattagaaccaactaaa
atctatcagccttcatatttgtctatcaacaatgaagttgaggaaaagacaatatctatt
tggcatgtgcttcctgatgacaagaaaggtatacatgagtggaattttagtgcttcttct
gtcaggggagtgagtatttctaaatttgaagaacgatgctgttttctttatgtgcttcat
aattctgacgatttccaaatctatttctgtacagaacttcattgtaaaaagttttttgaa
atggtgaacaccattaccgaagagaaggggagaagcacagaggaaggtgattgtgaaggt
gactccttggagtatgactacgaatatgatgagaacggagacagagttgttttaggaaag
ggcacttacgggattgtctacgcaggccgagacctgagcaaccaagtcagaattgctata
aaggaaatcccagaaagagatagcagatactcccagcccctacatgaagaaatagcattg
cataagcatctgaagcataaaaatattgtccagtatctgggctctttcagtgagaacggt
ttcatcaaaatcttcatggagcaggtcccaggaggaagtctttcagctctccttcgttcc
aaatggggcccattgaaggacaatgagcaaacaattggcttctatacaaagcaaatactt
gaaggattaaaatacctccatgacaatcagatagtccatcgggatataaagggtgacaat
gtgttgattaatacctacagtggcgttctcaagatctcagacttcgggacatcaaagagg
cttgctggcattaacccatgtactgaaacttttactggtacccttcagtatatggcacca
gaaatcatagacaaaggaccaagaggctacgggaaagcagcagacatttggtctttgggc
tgcacgatcatcgaaatggccacagggaagccacctttttatgaactgggagaaccacaa
gcagctatgttcaaggtgggaatgtttaaagtccacccggagatcccagagtccatgtcc
gcagaggccaaggcgttcatattgaaatgttttgaaccggaccccgacaagagagcctgt
gctaacgacttgcttattgacgagttcttaaaagtttcaagcaaaaagaagaagacgcaa
cctaagctttcagccctctcagctggatcaaatgcagagtatcttagaagcatatccttg
cccgtgcccgtcttggtggaggacaccagcagcagcagcgaatacggctcggtttctccg
gacacggagttgaaggtggatcccttctctttcaagacgagagccaaatcctgtggagag
cgagacgtaaaaggaatacggacactctttctgggcattccagacgaaaatttcgaagac
cacagtgctccaccctcccctgaagagaaagattctggattctttatgctgaggaaggac
agtgagagacgggccactcttcacaggatcctgaccgaagaccaagacaaagttgtgagg
aacttaatggaatctttggctcagggggctgaagaacctaaactaaaatgggaacacatc
acaaccctcattgcaagcctcagagaatttgtgagatccacggaccgaaaaatcatagcc
accacactgtctaagctgaagctagaacttgactttgacagccatggcatcagtcaagtt
caggtggtactcttcggttttcaagatgccgtcaataaagttcttcggaatcataacatc
aagccacactggatgtttgccttagacagtatcatccgaaaggcggtgcagacggccatc
accattctggtgccagaactgaggccacatttcagcctcgcatctgagagtgataccgcg
gatcaagaagacttggatgcggaagatgagcgtgaggaacagccttcaaaccaaaccgtc
caaagacctcatgctgtcattgaagatgccgtggctacctcaggggtgagcacgctcagt
tctactgtatcccatgactcccaaaatgctcaccgatcactcaatgtgcagcttggaagg
atgaaaatagaaactaatagattactggaagaattggttcagaaagagaaagaattacaa
gcactccttcatcaagctattgaagaaaaagaccacgaaattaaacacctgaagcttaag
tcccaaccaatagatattcctggagtgcctgtgtgtcaccgggattctctgggcacaaat
gctgaagagtctgaacttgctgaatggctgagagaaaagggagctgatgaagacactata
agtcggtttctggctgaggattattcactagaggatgttctctactatgttacacgtgat
gatttaaaatgcctgagactaaggggaggaatactctgcacgctgtggaaggccatcact
gactttcgagacaaacagacttga

DBGET integrated database retrieval system