KEGG   Felis catus (domestic cat): 101082936Help
Entry
101082936         CDS       T02385                                 

Gene name
AGTR1
Definition
(RefSeq) type-1 angiotensin II receptor
  KO
K04166  angiotensin II receptor type 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca04020  Calcium signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04072  Phospholipase D signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04261  Adrenergic signaling in cardiomyocytes
fca04270  Vascular smooth muscle contraction
fca04371  Apelin signaling pathway
fca04614  Renin-angiotensin system
fca04924  Renin secretion
fca04925  Aldosterone synthesis and secretion
fca04927  Cortisol synthesis and secretion
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca04934  Cushing syndrome
fca05200  Pathways in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101082936 (AGTR1)
   04020 Calcium signaling pathway
    101082936 (AGTR1)
   04072 Phospholipase D signaling pathway
    101082936 (AGTR1)
   04022 cGMP-PKG signaling pathway
    101082936 (AGTR1)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101082936 (AGTR1)
 09150 Organismal Systems
  09152 Endocrine system
   04924 Renin secretion
    101082936 (AGTR1)
   04614 Renin-angiotensin system
    101082936 (AGTR1)
   04925 Aldosterone synthesis and secretion
    101082936 (AGTR1)
   04927 Cortisol synthesis and secretion
    101082936 (AGTR1)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101082936 (AGTR1)
   04270 Vascular smooth muscle contraction
    101082936 (AGTR1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101082936 (AGTR1)
  09167 Endocrine and metabolic disease
   04933 AGE-RAGE signaling pathway in diabetic complications
    101082936 (AGTR1)
   04934 Cushing syndrome
    101082936 (AGTR1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101082936 (AGTR1)
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:fca04030]
    101082936 (AGTR1)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    101082936 (AGTR1)
G protein-coupled receptors [BR:fca04030]
 Rhodopsin family
  Peptide
   Angiotensin
    101082936 (AGTR1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx
Motif
Other DBs
NCBI-GeneID: 101082936
NCBI-ProteinID: XP_003992079
Ensembl: ENSFCAG00000000717
Position
C2
AA seq 362 aa AA seqDB search
MILNSSTEDGIKRIQDDCPKAGRHNYIFVMIPTLYSIIFVVGIFGNSLVVIVIYFYMKLK
TVASVFLLNLALADLCFLLTLPLWAVYTAMEYRWPFGNYLCKIASASVSFNLYASVFLLT
CLSIDRYLAIVHPMKARLRRTMLMAKVTCIVIWLLAGLASLPTIIHRNVFFIENTNITVC
AFHYESQNSTLPIGLGLTKNILGFLFPFLIILTSYTLIWKTLKRAYEIQKNKPRNDDIFK
IIMAIVLFFFFSWVPHQIFTFLDVLIQLGIIHDCKIADIVDTAMPITICIAYFNNCLNPL
FYGFLGKKFKKYFLQLLKYIPPKAKSHSNLSTKMSTLSYRPSDNGNTSAKKPASCIEVES
HT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgatcctcaactcttccactgaagatggtattaaaagaatccaagatgactgtcccaaa
gctggaaggcacaattacatatttgtcatgatccctactttatacagtatcatttttgtg
gtgggaatatttggaaacagcttggtagtgattgtcatttacttttacatgaaactgaag
actgtggccagtgtttttcttttgaatttagcactggctgacttatgctttttactgacc
ttaccactgtgggctgtctacactgccatggaatatcgctggccctttggcaattacctg
tgtaagatcgcttcagccagtgtcagtttcaacctctatgccagtgtgtttctactcaca
tgtctaagcatcgaccgttacctggctattgttcatccaatgaaagcccgccttcggcgt
acaatgcttatggccaaagtcacctgcatcgttatttggttattggctggcttggccagt
ttgccaactataatccaccgaaacgtgtttttcattgagaacaccaatatcacggtttgt
gctttccattatgaatcccaaaattcaaccctccccattgggctgggcttaactaagaat
atactgggtttcttgtttccttttctgatcattcttacaagttacactcttatttggaag
actctgaagagggcttatgagattcaaaagaacaagccaagaaatgatgatattttcaag
ataattatggcaattgtgcttttctttttcttttcctgggttccccaccaaatattcact
tttctggatgtattgattcagctgggcatcatacatgactgtaaaattgcagatattgtg
gacaccgccatgcccatcactatttgcatagcttattttaacaattgcctgaatcctctc
ttttatggctttctggggaaaaaatttaaaaaatattttctccagcttctgaaatacatc
cctccaaaggccaaatcccactcaaacctatcaacaaaaatgagcacactttcctaccgc
ccctcagataatggaaacacatccgccaagaagcctgcctcatgtattgaggttgagtca
cacacttga

DBGET integrated database retrieval system