KEGG   Felis catus (domestic cat): 101082989Help
Entry
101082989         CDS       T02385                                 

Gene name
DDC
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase isoform X1
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00350  Tyrosine metabolism
fca00360  Phenylalanine metabolism
fca00380  Tryptophan metabolism
fca01100  Metabolic pathways
fca04726  Serotonergic synapse
fca04728  Dopaminergic synapse
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
Module
fca_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
fca_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    101082989 (DDC)
   00360 Phenylalanine metabolism
    101082989 (DDC)
   00380 Tryptophan metabolism
    101082989 (DDC)
 09150 Organismal Systems
  09156 Nervous system
   04728 Dopaminergic synapse
    101082989 (DDC)
   04726 Serotonergic synapse
    101082989 (DDC)
 09160 Human Diseases
  09165 Substance dependence
   05030 Cocaine addiction
    101082989 (DDC)
   05031 Amphetamine addiction
    101082989 (DDC)
   05034 Alcoholism
    101082989 (DDC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101082989 (DDC)
Enzymes [BR:fca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     101082989 (DDC)
    4.1.1.105  L-tryptophan decarboxylase
     101082989 (DDC)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101082989 (DDC)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase
Motif
Other DBs
NCBI-GeneID: 101082989
NCBI-ProteinID: XP_003982662
Ensembl: ENSFCAG00000012257
Position
A2
AA seq 480 aa AA seqDB search
MNSSEFRRRGKEMTDFVADYLDGIEGRQVYPDVQPGYLRSLVPSTAPEEPDAFEDIINDV
ERIIMPGVTHWHSPYFFAYFPSANSYPAMLADMLCGAIGCIGFSWAASPACTELETVMMD
WLGKMLKLPEAFLAGEAGEGGGVIQGSASEATLMALLAARTKATRRLQAASPGLTQGAIM
EKLVAYSSDQAHSSVERAGLIGGVKMKAIPSDGKFAMRGSALQEAMERDRAEGLIPFFVV
ATLGTTSCCSFDSLLEVGPICNKEDMWLHIDAAYAGSSFICPEFRHLLNGVEFADSFNFN
PHKWLLVNFDCSAMWVKKRTDLTGAFKLDPVYLKHSHQDSGLITDYRHWQLPLGRRFRSL
KMWFVFRMYGVKGLQAYIRKHVQLAHEFEHLLHQDPRFEICAEVTLGLVCFRLKGSNKLN
EALLERINGTKKIHLVPCHLRDKFVLRFAICSRTVESAHVRLAWEHISQLASDLLGAEKE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgaactcaagcgaattccggaggagaggaaaggagatgacggacttcgtggcggactac
ttggacggcatcgagggacgccaggtctaccccgacgtgcagcctggctaccttcggtca
ctggtcccctctactgcccccgaggagccagacgcgtttgaggacatcatcaatgacgtt
gagaggataatcatgccaggggtgacgcactggcacagcccctacttctttgcctacttc
ccctcggccaactcgtacccggccatgctcgcggacatgctgtgcggggccatcggctgc
atcggcttctcctgggccgcgagtccggcgtgcacggagctggagacggtgatgatggac
tggctggggaagatgctgaagctgccagaggcgtttttggccggggaagcgggtgaaggg
ggtggagtgatccagggaagtgccagtgaggccactctgatggccctgctggccgctcga
accaaagcgacccgccgcctgcaggccgcctcccccgggctgacgcagggcgccatcatg
gaaaagctagtggcttactcatcggatcaggcccactcctcagtggaaagagccggatta
attggaggagtgaaaatgaaagccatcccttctgatggcaagtttgctatgcgtggttct
gccctgcaggaagctatggagagagacagggcggagggcctgattcctttctttgtggtg
gctacgctggggaccacgtcctgctgctcattcgacagtctcttagaagtgggtccgatc
tgtaacaaggaggacatgtggctgcacatcgacgccgcctacgcgggcagctccttcatc
tgccctgagttccggcatcttctgaacggagtcgagtttgcagactcatttaacttcaat
ccgcacaaatggctgctggtgaatttcgactgctctgccatgtgggtgaaaaagaggaca
gacctaaccggagcctttaagctggaccctgtctacttaaagcacagccatcaggactca
gggcttatcaccgactatcggcactggcagttgccgctgggccgaaggtttcgctctctg
aagatgtggtttgtttttaggatgtacggcgtcaagggactgcaggcttacatccgcaag
cacgtccagctggcccacgagtttgaacatctgctgcaccaggaccctcgctttgaaatc
tgcgcggaggtcactctggggctggtctgttttcggctcaagggttccaacaagctgaat
gaagctcttctggaaagaataaacggcaccaaaaaaatccacttggttccatgtcacctg
agggacaagttcgtgcttcgttttgccatctgctcccgcaccgtggaatctgcacacgtg
cggctggcctgggagcacatcagccagctggccagcgacctgctgggtgcagagaaggaa
tag

DBGET integrated database retrieval system