KEGG   Felis catus (domestic cat): 101083063
Entry
101083063         CDS       T02385                                 

Gene name
ERAP1
Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1 isoform X1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
fca  Felis catus (domestic cat)
Brite
KEGG Orthology (KO) [BR:fca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:fca01002]
    101083063 (ERAP1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     101083063 (ERAP1)
Peptidases and inhibitors [BR:fca01002]
 Metallo peptidases
  Family M1
   101083063 (ERAP1)
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 101083063
NCBI-ProteinID: XP_011283026
Ensembl: ENSFCAG00000004966
UniProt: A0A2I2UQW0
Position
A1
AA seq 977 aa
MDTVPLHWIFIQLPSSMTESIFLQARRNNGSVSKKMISLSVKWPLGTMPLLLSSLLILLT
VSTPSWCQSSDTSSPKASNGSPFPWDKIRLPEHISPVHYDLMIHANLTTLTFEGTTQIEI
TASQPTTTIILHSHHLQISKATLRKRVGERLTAEPLRVLEYPLHEQIALLAPEPLVVGLL
YTVVIDYAGTLSEHLNGFYKSTYRTKEGEVRVLASTHFEPTAARMAFPCFDEPSFKANFS
VKIRREPRHLSISNMPLVKSVTIAEGLIEDHFDVTVKMSTYLVAFIISDFKSVSKMTKSG
IKVSIYAVPDKIHQADYALDAAVTLLEFYEDYFSIPYPLPKQDLAAIPDFESGAMENWGL
TTYRESVLLFDSEKSSASNKLGITLTVSHELAHQWFGNLVTMEWWNDLWLNEGFAKFMEF
VSVTVTHPELKVEDYFFGKCFDVMEVDALNSSHPVSTAVENPAQIREMFDEVSYEKGACI
LNMLRDYLSADAFKSGIVQYLQKYSYKNTKNEDLWNSMASICPADDTQRMDGFCSRGAHS
SSSSHWRQEGLDVKTMMNTWTLQKGFPLITITVRGRNVHMKQEHYRKGPDDASETGYLWH
VPLTFITSKSDSVQRFLLKTKTDVLILPEEVEWIKFNVGMNGYYIVHYEDDGWNSLSGLL
RGAHTTISSNDRASLINNAFQLVSNGKLSIEKALDLTLYLKHETEIMPVFQGLNELIPMY
KLMEKRDMKEVENQFKAFLIRLLRDLIDNQTWTDEGSVSQRMLRSELLLLACMCKYQPCV
QRAEAYFREWKEAGGNLSLPSDVTLAVFAVGVQNPEGWDFLYSKYQSSLSSTEKNEIEFA
LSISQNEGKLQWLLDESFKGDKIKIQEFPHILRAVGRNPVGYPLAWQFLRENWDKLIQKF
ELGSSSLTNMVIGTTNQFSTRARLEEVKGFFSSLKENSSQLRCVQQTIETIEENIRWMDK
NFDKIRVWLQSEKLALL
NT seq 2934 nt   +upstreamnt  +downstreamnt
atggatacagttccacttcattggatatttattcaacttccctcatcaatgactgaaagt
atttttctacaggcaagaaggaataatggtagtgtgagcaagaagatgatatctctgtcc
gtcaaatggccacttggaaccatgccgcttctactgtcctcactgttgattctcttaact
gtgtcaactccttcctggtgtcagagcagtgacacctcgtctccaaaagctagtaatggg
tcaccattcccttgggataaaattcgacttcctgagcacatcagcccggttcattatgat
ctcatgatccatgcaaatctcaccactctgactttcgagggaaccactcaaatagaaatc
acagccagccagcctaccactaccatcatcctgcatagtcaccacctgcaaatatctaag
gccaccctcaggaagagagttggagagagactgactgcagaaccgttgagagtcctggaa
tacccgcttcatgagcaaatcgcacttctggctcccgagcctctggttgttgggctcctg
tacacagttgtcattgactatgctggcaccctttctgagcatttaaatggattttataaa
agcacctacagaaccaaggaaggggaagtaagagtacttgcatcaacacattttgaacct
actgcagcccggatggcctttccctgttttgatgaaccttccttcaaagcaaatttttca
gtcaagatcagaagggagccaaggcacctgtccatctccaatatgccactggttaaatct
gtgactattgctgaaggactcatagaagaccattttgatgtcactgtgaagatgagcacc
tacctggtggctttcattatttcagattttaagtctgttagcaagatgaccaagagtgga
atcaaggtttccatatatgctgtgccagacaagatacatcaggcagattatgcactggat
gctgcagtgactcttctagagttttatgaggattatttcagcattccatatcccttaccc
aaacaagatcttgctgctattcctgactttgagagtggcgctatggaaaactggggactg
accacatacagagaatctgttctattgtttgattctgaaaagtcttctgcatcaaataag
cttggcattactttgactgtgtcccatgaactcgcccaccagtggtttgggaatctcgtg
actatggaatggtggaatgatctttggctaaatgagggatttgcgaagtttatggagttt
gtgtctgtcactgtgactcatccagaactgaaagttgaagattatttctttggcaagtgt
tttgatgtgatggaggtagacgcattaaattcttcacaccctgtgtcgacagctgtagag
aatcctgctcagattcgggaaatgtttgatgaagtttcttatgaaaagggagcttgtatt
ctgaatatgctaagggattatctcagtgctgatgcatttaaaagtggtattgtacagtat
ctccagaagtatagctataaaaacacaaaaaatgaggacctgtggaatagtatggcaagt
atttgtcctgccgatgacacacaaagaatggatggcttttgctccaggggtgcacattca
tcctcatcctcacactggcgtcaggaaggccttgatgtgaaaaccatgatgaacacgtgg
acgctgcaaaaaggctttcccctgataaccatcacggtgagagggaggaatgtacacatg
aagcaagagcactacaggaaaggacctgatgacgcctcagaaactgggtacctgtggcat
gttccattgacattcattacgagcaaatcagattcagtccaaagatttttgctgaagaca
aaaacagatgtgctcattctcccagaagaggtagaatggatcaaatttaatgttggaatg
aatggctattacattgtgcattatgaggatgatggatggaattctttgagtggtctttta
agaggagcacatacaacaatcagcagcaatgatcgggccagtctcattaacaatgcattt
cagcttgtcagcaatggaaagctatcaattgaaaaagccttggatttaaccctatacttg
aagcatgaaactgaaattatgcccgtgttccaaggtttgaatgagctgatacctatgtat
aaactgatggagaaaagagatatgaaggaagtggaaaatcagttcaaggcctttctcatc
aggctgctgagggacctcattgataatcagacgtggacagatgagggctcagtctcacag
cgaatgctgcggagtgagctcctcctccttgcctgcatgtgcaagtatcagccctgtgta
cagagggcagaagcctatttcagagagtggaaggaagctggtggaaatttgagcctgccc
agtgatgtaaccttggcggtgttcgctgtgggggtccagaaccctgaaggatgggatttt
ctttatagtaaatatcagtcatctttgtccagtaccgagaaaaacgaaattgaatttgcc
ctcagtattagccaaaatgagggaaagcttcagtggctactagatgaaagctttaaggga
gataaaataaaaattcaagagtttccacatatccttagagctgttggcaggaacccggtg
ggatatccattggcctggcagtttctgagggaaaattgggataaacttatacaaaagttt
gaacttggctcatcttctttaacaaatatggtaataggaacaacaaatcagttctccaca
agagcacggcttgaggaggtaaaaggattcttcagctccttgaaagaaaacagttctcag
ctccgttgtgtccagcaaacaattgaaaccattgaggaaaacattcgttggatggataag
aattttgataaaatcagagtgtggctccaaagcgagaagcttgcactgctctaa

DBGET integrated database retrieval system