KEGG   Felis catus (domestic cat): 101083159Help
Entry
101083159         CDS       T02385                                 

Gene name
SSBP1
Definition
(RefSeq) single-stranded DNA-binding protein, mitochondrial isoform X1
  KO
K03111  single-strand DNA-binding protein
Organism
fca  Felis catus (domestic cat)
Pathway
fca03030  DNA replication
fca03430  Mismatch repair
fca03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    101083159 (SSBP1)
   03430 Mismatch repair
    101083159 (SSBP1)
   03440 Homologous recombination
    101083159 (SSBP1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:fca03032]
    101083159 (SSBP1)
   03400 DNA repair and recombination proteins [BR:fca03400]
    101083159 (SSBP1)
   03029 Mitochondrial biogenesis [BR:fca03029]
    101083159 (SSBP1)
DNA replication proteins [BR:fca03032]
 Prokaryotic Type
  DNA Replication Initiation Factors
   Initiation factors (bacterial)
    101083159 (SSBP1)
DNA repair and recombination proteins [BR:fca03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    Other MMR factors
     101083159 (SSBP1)
  TLS (translesion DNA synthesis) factors
   Other SOS response factors
    101083159 (SSBP1)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial DNA replication factors
   Other Mitochondrial DNA replication factors
    101083159 (SSBP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SSB
Motif
Other DBs
NCBI-GeneID: 101083159
NCBI-ProteinID: XP_006929489
Ensembl: ENSFCAG00000006568
UniProt: A0A2I2V3I8
Position
A2
AA seq 150 aa AA seqDB search
MFRRPVLQVFHQFVRRESEIASSLVLERSLNRVQLLGRVGQDPVMRQVEGKNPVTIFSLA
TNEMWRSGESEVYQMDLGDVSQKTTWHRISVFRPGLRDVAYQYVKKGSRIYVEGKVDYGE
YTDKNNVRRQATTIIADNIIFLSDQTKEKA
NT seq 453 nt NT seq  +upstreamnt  +downstreamnt
atgtttcggagacctgtattacaggtgtttcatcagtttgtaagacgtgagtctgaaata
gccagcagcttggttcttgaaagatctctgaaccgtgtgcagctccttgggcgagtgggt
caggaccccgtcatgagacaggtggaagggaagaacccggtcacaatattttctctagca
acgaatgagatgtggcggtcaggggagagtgaagtataccaaatggatttaggtgatgtc
agtcaaaagacgacatggcacagaatatcagtattccgaccaggcctcagagatgtggcg
tatcagtatgtgaaaaaggggtcccgtatctatgtggaagggaaagtcgactatggtgaa
tacacagataaaaacaatgtgaggcgacaggcaacaacaatcatagctgataatattata
tttctgagtgaccagaccaaagaaaaggcatag

DBGET integrated database retrieval system