KEGG   Felis catus (domestic cat): 101083193Help
Entry
101083193         CDS       T02385                                 

Gene name
APH1A
Definition
(RefSeq) gamma-secretase subunit APH-1A
  KO
K06172  gamma-secretase subunit APH-1A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca05010  Alzheimer disease
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101083193 (APH1A)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101083193 (APH1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aph-1 Peptidase_M3_N
Motif
Other DBs
NCBI-GeneID: 101083193
NCBI-ProteinID: XP_003990614
Ensembl: ENSFCAG00000030589
UniProt: M3XG97
Position
C1
AA seq 265 aa AA seqDB search
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLSCRRQEDSRVMVYSALRIPPED
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgggggccgcagtatttttcggatgcactttcgtcgctttcggcccggcctttgcgctt
ttcttgatcactgtcgctggggaccctcttcgcgtcatcatcctggtggcgggggcattt
ttctggctggtctccctgctcttggcctctgtggtctggttcatcttggtccatgtgacc
gacaggtcagatgcccggctccagtatggcctcctgatttttggtgctgcggtctctgtc
cttctacaggaggtgttccgctttgcctactacaagctgcttaagaaggcagatgagggg
ttagcatcgctgagtgaggacggaagatcacccatctccatccgccagatggcctatgtt
tctggtctttccttcggtatcatcagtggtgtcttctctgttatcaatattttggctgat
gcacttgggccaggtgtggttgggatccatggagactcaccctattacttcctgacttca
gcctttctgacagcagccattatcctgctccataccttttggggagttgtgttctttgat
gcctgtgagaggagacggtactgggctttgggcctggtagtcgggagtcacctactgacc
tcgggactgacattcctgaatccctggtatgaggccagcctgctgcccatctatgcagtc
actgtttccatggggctttgggccttcatcacagctggagggtccctccgaagtatccag
cgcagcctctcgtgccgacggcaggaggacagtcgggtgatggtgtattctgccctgcgc
atcccacccgaggactga

KEGG   Felis catus (domestic cat): 102902223Help
Entry
102902223         CDS       T02385                                 

Gene name
APH1B
Definition
(RefSeq) gamma-secretase subunit APH-1B isoform X1
  KO
K06172  gamma-secretase subunit APH-1A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca05010  Alzheimer disease
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    102902223 (APH1B)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    102902223 (APH1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aph-1
Motif
Other DBs
NCBI-GeneID: 102902223
NCBI-ProteinID: XP_019687853
Position
B3
AA seq 257 aa AA seqDB search
MTAAVFFGCAFIAFGPALALYIFTIATEPLRVIFLIIGAFFWLVSLLFSSLFWFMARTIT
DNKDGPIQKYLLILGVLVSVLVQEMFRFAYYKLLKKANEGLRSINPDETAPSMRLLAYVS
GLGFGIMSGVFSFVNTLSDSLGPGTVGIHGDSPQFFLNSAFMTLVIILLHVFWGIIFFDG
CEKKKWSALLVVLLTHLLVSALTFISPHYGINLVSTYIIVVLMGIWAFFVAGGSCRSLKL
CLLCQDKDFLLFNQRSR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgacggcggccgtgttcttcggctgcgccttcattgccttcgggcctgcgctggccctc
tacatcttcaccatcgccactgagccgttgcgcgtcatcttcctcatcatcggagctttt
ttctggttggtatctctgctgttttcgtccctgttttggttcatggcaagaaccattact
gacaacaaagatggaccaatacagaaatatctgctgatcttgggagtgttagtctccgtc
cttgtccaagaaatgtttcgatttgcatattataaacttttgaaaaaagccaatgagggt
ttgaggagtataaacccagacgagacagcaccctctatgcgattgctggcctatgtttct
ggcttgggttttggaatcatgagtggagtattttcctttgtaaataccctttctgactcc
ttgggaccaggcacagtgggcattcatggagactctcctcagttcttcctaaattcagct
ttcatgacgctggttatcatattgctgcacgtgttctggggcatcatattttttgatggc
tgtgagaagaaaaagtggtctgcccttcttgtagttcttctgacccatctgctggtgtca
gccctgaccttcataagtcctcattatggaataaatttggtgtcaacatatataattgtg
gtactcatgggcatttgggcattctttgttgctggcggcagctgccgaagcctgaaactg
tgcctcctctgccaagacaaggacttcctccttttcaatcagcgttccagataa

DBGET integrated database retrieval system