KEGG   Felis catus (domestic cat): 101083489Help
Entry
101083489         CDS       T02385                                 

Gene name
SHC2
Definition
(RefSeq) SHC-transforming protein 2 isoform X1
  KO
K17447  SHC-transforming protein 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04370  VEGF signaling pathway
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca05034  Alcoholism
fca05100  Bacterial invasion of epithelial cells
fca05214  Glioma
fca05220  Chronic myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101083489 (SHC2)
   04012 ErbB signaling pathway
    101083489 (SHC2)
   04370 VEGF signaling pathway
    101083489 (SHC2)
   04072 Phospholipase D signaling pathway
    101083489 (SHC2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101083489 (SHC2)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101083489 (SHC2)
   04062 Chemokine signaling pathway
    101083489 (SHC2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101083489 (SHC2)
   04915 Estrogen signaling pathway
    101083489 (SHC2)
   04917 Prolactin signaling pathway
    101083489 (SHC2)
   04926 Relaxin signaling pathway
    101083489 (SHC2)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101083489 (SHC2)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101083489 (SHC2)
   05226 Gastric cancer
    101083489 (SHC2)
   05214 Glioma
    101083489 (SHC2)
   05220 Chronic myeloid leukemia
    101083489 (SHC2)
   05224 Breast cancer
    101083489 (SHC2)
  09165 Substance dependence
   05034 Alcoholism
    101083489 (SHC2)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101083489 (SHC2)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101083489 (SHC2)
   01522 Endocrine resistance
    101083489 (SHC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2
Motif
Other DBs
NCBI-GeneID: 101083489
NCBI-ProteinID: XP_023098186
Ensembl: ENSFCAG00000015438
Position
A2
AA seq 581 aa AA seqDB search
MTQGPGGRTPPAPPAPPEPEAPTTFCALLPRMPQWKFAAPAGFLGRGPAAARAAGGAGAA
DSQPEPAGPASVPALAAAVLGACEPRCAAPCPLPALSRCRAAGGRGPRGARGAAGPADAS
ADEWIRKGSFIHKPAHGWLHPDARVLGPGVSYIVRYMGCIEVLRSMRSLDFNTRTQVTRE
AINRLHEAVPGIRGSWKKKAPNKALASILGKTNLRFAGMSIAVSISTDGLNLSVPATRQV
IANHHMQSISFASGGDTDMTDYVAYVAKDPINQRACHILECCEGLAQSIISTVGQAFELR
FKQYLHSPPRVVLPPERLTRPEESAWGDEEETEHNYYNSIPGKEPPLGGLVDSRLALTQP
CAVGALGQGVSPARRDTRSLPWDLGPSGPPGDGYVQADARGPRDYEDHLYVNTQGLDAPE
PLQPEDSPKKDLFDMRPFEDALKLHECSAGAGAAVAPLPLEDQWPSPPTRRAPIAPTEEQ
LRQEPWYHGQMSRRAAEKLLRADGDFLVRDSVTNPGQYVLTGMHAGQPKHLLLVDPEGVV
RTKDVLFESISHLIDYHLQNGQPIVAAESELHLRGVVKREP
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atgacgcagggtccgggcgggcgcacgccccccgcgccccccgcgcccccggagcccgag
gcgcccaccaccttctgcgcgctgctgccgcgcatgccgcagtggaagttcgctgccccc
gcgggcttcctgggccggggccccgcggcagctcgggcggccgggggcgcgggggccgcc
gactcccagcccgagccggccggtccggccagcgtccctgcgctggcggccgcggtcctg
ggcgcctgcgagccgcgctgcgccgcgccctgtccgctgccggcgctcagccgctgccgg
gccgccggcggcaggggcccgcggggcgcgcggggggcggccgggcccgcggacgccagc
gccgacgagtggatccgcaaaggcagcttcatccacaagccggcgcacggctggctgcac
ccagacgccagggtcctggggcccggggtctcctacatcgtgcggtacatgggctgcatc
gaagtcctccgctccatgcgctctctggattttaacactcgcacccaggtgaccagggaa
gccatcaaccggctccatgaggcagtgcctggcatccggggctcctggaagaagaaggcc
ccgaacaaggcactggcctccatcctgggcaagaccaacctgcgcttcgctggcatgagc
atcgctgtgagcatctccaccgacggcctcaacctgtccgtgcctgccacgcgccaggtc
attgccaaccaccacatgcagtctatctcctttgcgtcgggaggtgacacggacatgact
gattatgtggcctatgtagccaaggatcccatcaaccagagagcctgccacatcctggag
tgctgtgagggcctcgcccagagcatcatcagcaccgtgggccaagccttcgagctgcgc
ttcaaacagtacctgcacagcccccccagggtggtcctgcccccggaaaggctgaccagg
cccgaggagtcggcctggggggacgaggaggaaacggaacacaattactacaacagcatc
ccagggaaggagccgcccctgggtgggctggtggactccaggctcgccctaactcaaccc
tgtgccgtcggcgccctcggccagggcgtatcgcctgctcgaagggacacccgcagtctg
ccgtgggacctgggcccctcaggcccaccaggggatggctacgtgcaggctgatgcacgg
ggccccagagactatgaggaccacctgtacgtcaacacacagggtctggatgccccagag
cccctgcagccggaggacagccccaagaaggacctgttcgacatgcgacccttcgaggac
gctctgaagctgcacgagtgctctgcgggggcgggggcggcggtagcgccccttcccttg
gaggaccagtggcccagcccccccacccgccgggcccccatcgcccccacggaggagcag
ctgcggcaggagccctggtaccatggccagatgagccgaagggccgcagagaagctgctt
cgagccgacggggacttcctggtgcgcgacagcgtcaccaatcccgggcagtacgtcctc
acaggcatgcacgcggggcagcccaagcacctgctacttgtggaccctgagggcgtggtg
cggacgaaggatgtgctctttgagagcatcagccatctgatcgactaccacctgcagaat
gggcaacccatcgtggcggccgaaagcgagctgcatctgcgcggcgtggtcaaacgcgag
ccctga

KEGG   Felis catus (domestic cat): 101092911Help
Entry
101092911         CDS       T02385                                 

Gene name
SHC1
Definition
(RefSeq) LOW QUALITY PROTEIN: SHC-transforming protein 1
  KO
K06279  SHC-transforming protein 1
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca05034  Alcoholism
fca05100  Bacterial invasion of epithelial cells
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05220  Chronic myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101092911 (SHC1)
   04012 ErbB signaling pathway
    101092911 (SHC1)
   04072 Phospholipase D signaling pathway
    101092911 (SHC1)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101092911 (SHC1)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101092911 (SHC1)
   04062 Chemokine signaling pathway
    101092911 (SHC1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101092911 (SHC1)
   04915 Estrogen signaling pathway
    101092911 (SHC1)
   04917 Prolactin signaling pathway
    101092911 (SHC1)
   04926 Relaxin signaling pathway
    101092911 (SHC1)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101092911 (SHC1)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101092911 (SHC1)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101092911 (SHC1)
   05226 Gastric cancer
    101092911 (SHC1)
   05214 Glioma
    101092911 (SHC1)
   05220 Chronic myeloid leukemia
    101092911 (SHC1)
   05224 Breast cancer
    101092911 (SHC1)
  09165 Substance dependence
   05034 Alcoholism
    101092911 (SHC1)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101092911 (SHC1)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101092911 (SHC1)
   01522 Endocrine resistance
    101092911 (SHC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 101092911
NCBI-ProteinID: XP_003999780
Ensembl: ENSFCAG00000001346
Position
F1
AA seq 583 aa AA seqDB search
MDLLPPKPKYNPLRNESLSSLEEGASGSTPPEEPPSPSASSLGPILPPLPGDESPTTLCS
FFPRMSNLKLANPAGGRPGPKGEPGRVAEDGEGIVGAAAPDSGPLPLLQDMNKLSGGGGR
RTRVEGGQLGGEEWTRHGSFVNKPTRGWLHPNDKVMGPGVSYLVRYMGCVEVLQSMRALD
FNTRTQVTREAISLVCEAVPGAKGATRRRKPCGRPLSSVLGRSNLKFAGMPITLTVSTSS
LNLMAADCKQIIANHHMQSISFASGGDPDTAEYVAYVAKDPVNQRACHILECPEGLAQDV
ISTIGQAFELRFKQYLRNPPKLVTPHDRMAGFDGSAWDEEEEEPPDHQYYNDFPGKEPPL
GGVVDMRLREGAPPGAARPTPPGVQTPSHLGATLPVGQPVGGDPEIRKQMPPPPPCPGRE
LFDDPSYVNVQNLDKARQGGGGAGPPNPAINGSAPRDLFDMKPFEDALRVPPPPQSVAMA
EQLRGEPWFHGKLSRREAEALLQLNGDFLVRESTTTPGQYVLTGLQSGQPKHLLLVDPEG
VVRTKDHRFESVSHLISYHVDNHLPIISAGSELCLQQPVERKL
NT seq 1752 nt NT seq  +upstreamnt  +downstreamnt
atggatctcctgccccccaagcccaagtacaatccgcttcggaatgagtctctgtcatcg
ctggaggagggggcttcggggtccaccccgccggaggagccgccttccccctcggcctcg
tccctggggcctatcctgcctcctctgcctggggacgagagtcccaccaccctgtgctcc
ttcttcccccggatgagcaacctgaagctggccaacccagctggggggcgcccggggcca
aagggggagccagggagggtggctgaggatggggaggggatcgtaggggcggccgcgcca
gactcaggccccctgcccctcctccaggacatgaacaagctgagtggaggcggcgggcgc
aggactcgggtggaagggggccagctggggggcgaggagtggacccgccacgggagcttt
gtcaataagcccacgcggggctggctgcatcccaacgacaaagtcatgggacccggggtt
tcctacttggttcggtacatgggctgtgtggaggtcctgcagtcgatgcgcgccctggac
ttcaacacccgcacccaggtcaccagggaggccatcagtctggtgtgtgaggctgtgccc
ggtgcgaagggggcaacaaggaggagaaagccctgtggccgcccgctcagctccgttctg
gggaggagtaacctgaagtttgcaggaatgccgatcactctcaccgtctccaccagcagc
ctcaacctcatggccgcagattgcaaacagatcatcgccaaccaccacatgcagtctatc
tcatttgcgtccggtggggacccggacacagctgagtacgtcgcctatgttgccaaagac
ccggtcaatcagagagcctgccacatcctggagtgtcccgaagggcttgctcaggacgtc
atcagcaccatcggccaggccttcgagctgcgcttcaaacaatacctcaggaacccgccc
aagctggtcacccctcacgacaggatggctggttttgatggctcggcttgggacgaggag
gaggaagagccacctgaccaccagtactataatgacttcccggggaaggagccgcctctc
gggggagtggtggacatgaggcttcgggaaggagctccccccggggctgctcgacccact
ccacccggggtgcagacccccagccacctgggagcaacgctgcccgtggggcagcctgtt
gggggagacccagaaattcgcaaacagatgccacctccaccgccctgcccaggtagggag
ctcttcgacgatccttcctacgtcaacgtccagaacctggacaaggcccggcaaggaggg
ggtggggccgggccccccaatcctgccatcaatggcagcgcgccccgagacctctttgac
atgaagcccttcgaggatgcccttcgcgtgcctccacctccccagtcagtggccatggcc
gagcagctgcgaggggagccctggttccacgggaagctgagccggcgggaggcggaggcc
ctgctgcagctcaacggggacttcctggtgcgggaaagcacgaccacgccgggccagtac
gtgctcaccggcctgcagagtgggcagcccaagcacctgctcctggtggacccggagggc
gtggttcggacaaaggatcaccgctttgagagcgtcagccacctcatcagctaccatgtg
gacaatcacttgcccatcatctctgcgggcagtgaactatgtctccagcagcctgtggag
cggaagctgtga

KEGG   Felis catus (domestic cat): 101095865Help
Entry
101095865         CDS       T02385                                 

Gene name
SHC3
Definition
(RefSeq) SHC-transforming protein 3
  KO
K17448  SHC-transforming protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca05034  Alcoholism
fca05100  Bacterial invasion of epithelial cells
fca05214  Glioma
fca05220  Chronic myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101095865 (SHC3)
   04012 ErbB signaling pathway
    101095865 (SHC3)
   04072 Phospholipase D signaling pathway
    101095865 (SHC3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101095865 (SHC3)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101095865 (SHC3)
   04062 Chemokine signaling pathway
    101095865 (SHC3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101095865 (SHC3)
   04915 Estrogen signaling pathway
    101095865 (SHC3)
   04917 Prolactin signaling pathway
    101095865 (SHC3)
   04926 Relaxin signaling pathway
    101095865 (SHC3)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101095865 (SHC3)
 09160 Human Diseases
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101095865 (SHC3)
   05226 Gastric cancer
    101095865 (SHC3)
   05214 Glioma
    101095865 (SHC3)
   05220 Chronic myeloid leukemia
    101095865 (SHC3)
   05224 Breast cancer
    101095865 (SHC3)
  09165 Substance dependence
   05034 Alcoholism
    101095865 (SHC3)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101095865 (SHC3)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101095865 (SHC3)
   01522 Endocrine resistance
    101095865 (SHC3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2
Motif
Other DBs
NCBI-GeneID: 101095865
NCBI-ProteinID: XP_023098988
Ensembl: ENSFCAG00000004212
Position
D4
AA seq 587 aa AA seqDB search
MLPRTKYNRFRNDSVTSVDDLLHNLSVSGGGKVSAARAAPAAAPYLVSGDALRRAPDDGP
GSLGHLLHKVSHLKLSSSGLRGRSAARARAGARLSGSCSAPSLAAPDGSAPPGPGAPAMR
AARKGRPGDQPPPRAPHASDQVLGAGVTYVVKYLGCIEVLRSMRSLDFSTRTQITREAIS
RVCEAVPGAKGAFRKRKPPSKMLSSILGKSNLQFAGMNISLTVSTASLNLRTPDSKQIIA
NHHMQSISFASGGDPDTTDYVAYVAKDPVNRRACHILECCDGLAQDVIGSIGQAFELRFK
QYLQCPSKVPAFHDRMQSLDEPWTEEEGDGSDHPYYNSIPSKAPPPGGFVDVRLQARPHA
PDTAQFAGKEQTYYQGRHLGEPFGEDWKQAPVRQGSLDTYSLPEGRTHAGPGEAPTYVNA
QHIPPQATPASGSSAESSPRKDLFDMKPFEDALRNQSSGPVLSKAASVECISPVTPRAPD
AKMLEELEGEPWYQGEMSRKEAEGLLKNDGDFLVRKSATNPGSFVLTGMHNGQAKHLLLV
DPEGTVRTKDRVFDSISHLINHHLENSLPIVSAGSELCLQQPVEKPL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atgcttccacgcaccaagtacaaccgcttcaggaatgactcggtgacatcggtcgacgac
cttctgcacaacctgtcggtgagcggcggcggcaaggtctcggcggcgcgcgcggccccg
gcggcggccccctacctcgtgtccggagacgcgctgcgcagggcgcccgacgatgggccg
ggcagcctgggccacctgctccacaaggtgtcccacctgaaactctccagctcgggcctc
cgcggccgctcggcggccagggcgcgggcgggcgcgcggctctcgggcagctgcagcgcg
cccagcctggccgccccggacggcagcgcgccccccggccccggcgccccggccatgcgc
gccgccaggaagggccggcccggcgaccagccgccgccgcgcgccccgcacgccagcgac
caggtgctgggggccggagtcacctacgtcgtcaagtacttggggtgcattgaagttctc
cgctcaatgaggtctcttgacttcagtacaagaacacagattaccagggaagccatcagc
cgcgtctgcgaagccgtccctggcgccaagggagccttcaggaagagaaagcctcccagc
aaaatgctgtccagcatcttgggcaagagcaacctccagtttgcgggcatgaacatctcc
ctgaccgtgtccaccgccagcctgaacttgcggacgcccgactccaaacagatcatcgcc
aaccaccacatgcagtccatctcgttcgcctccgggggagacccggacacaaccgactac
gttgcgtacgtagctaaggaccctgttaaccgcagagcgtgtcacattctggagtgctgc
gacgggctggcccaggatgtcatcggctccatcggacaggcctttgaactccggtttaag
cagtatttgcagtgtccttccaaggtccccgctttccatgaccgaatgcagagtctggac
gagccttggaccgaagaggagggggatggctcagaccacccgtactacaacagcatccca
agcaaggcgccccctccggggggctttgtggacgtgcggctgcaagccagaccccacgcc
cctgacacggcccagtttgcaggcaaagagcagacgtactaccaggggagacacctggga
gagccgttcggcgaagactggaagcaagcacctgtccggcaagggtccttggatacctac
agtctgccggaagggagaactcacgcgggccccggagaagcccccacttatgtgaacgcc
cagcacatcccgccgcaggccacaccggcctccggcagcagcgcggagagcagcccgcgg
aaagacctcttcgacatgaaaccctttgaagacgctctcaggaaccagtcctcggggcct
gtgctgagcaaggcggcctccgtggagtgcatcagccctgtcacgcccagagcccccgat
gccaagatgctggaggagctggaaggggagccttggtaccaaggggagatgagccggaag
gaggccgaggggctgctgaagaacgacggggacttcctggtcaggaagagcgccaccaac
ccgggctccttcgtcctcacgggcatgcacaacggccaggccaagcacctgctgctcgtg
gacccggagggcacggtccggacgaaggacagggtcttcgacagcatcagccacctcatc
aaccaccacctggagaatagcctgcccatcgtctctgctggaagcgagctctgtctccag
cagccggtggagaaacccctgtga

KEGG   Felis catus (domestic cat): 101099050Help
Entry
101099050         CDS       T02385                                 

Gene name
SHC4
Definition
(RefSeq) SHC-transforming protein 4
  KO
K17449  SHC-transforming protein 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca01521  EGFR tyrosine kinase inhibitor resistance
fca01522  Endocrine resistance
fca04012  ErbB signaling pathway
fca04014  Ras signaling pathway
fca04062  Chemokine signaling pathway
fca04072  Phospholipase D signaling pathway
fca04510  Focal adhesion
fca04650  Natural killer cell mediated cytotoxicity
fca04722  Neurotrophin signaling pathway
fca04910  Insulin signaling pathway
fca04915  Estrogen signaling pathway
fca04917  Prolactin signaling pathway
fca04926  Relaxin signaling pathway
fca05034  Alcoholism
fca05100  Bacterial invasion of epithelial cells
fca05206  MicroRNAs in cancer
fca05214  Glioma
fca05220  Chronic myeloid leukemia
fca05224  Breast cancer
fca05225  Hepatocellular carcinoma
fca05226  Gastric cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101099050 (SHC4)
   04012 ErbB signaling pathway
    101099050 (SHC4)
   04072 Phospholipase D signaling pathway
    101099050 (SHC4)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101099050 (SHC4)
 09150 Organismal Systems
  09151 Immune system
   04650 Natural killer cell mediated cytotoxicity
    101099050 (SHC4)
   04062 Chemokine signaling pathway
    101099050 (SHC4)
  09152 Endocrine system
   04910 Insulin signaling pathway
    101099050 (SHC4)
   04915 Estrogen signaling pathway
    101099050 (SHC4)
   04917 Prolactin signaling pathway
    101099050 (SHC4)
   04926 Relaxin signaling pathway
    101099050 (SHC4)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101099050 (SHC4)
 09160 Human Diseases
  09161 Cancer: overview
   05206 MicroRNAs in cancer
    101099050 (SHC4)
  09162 Cancer: specific types
   05225 Hepatocellular carcinoma
    101099050 (SHC4)
   05226 Gastric cancer
    101099050 (SHC4)
   05214 Glioma
    101099050 (SHC4)
   05220 Chronic myeloid leukemia
    101099050 (SHC4)
   05224 Breast cancer
    101099050 (SHC4)
  09165 Substance dependence
   05034 Alcoholism
    101099050 (SHC4)
  09171 Infectious disease: bacterial
   05100 Bacterial invasion of epithelial cells
    101099050 (SHC4)
  09176 Drug resistance: antineoplastic
   01521 EGFR tyrosine kinase inhibitor resistance
    101099050 (SHC4)
   01522 Endocrine resistance
    101099050 (SHC4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PID SH2 Delta_lysin
Motif
Other DBs
NCBI-GeneID: 101099050
NCBI-ProteinID: XP_023111153
Ensembl: ENSFCAG00000029990
Position
B3
AA seq 630 aa AA seqDB search
MRKRGQDSLAGLVLYVGLFGHPGMLHRAKYSRFRNESITSLDESSPGGSVGSKGSAPPPY
PTLAPHLPAEDATLASQESPTPLCTLIPRMASVKLANPATLLSLKNFCLGTKEVPRLKLQ
ESQDPAPSSPASPETSPNRAGSAPLPQPDLLGHRAAALTPDACPLPGPGEPTPGSRQDRH
FLQHLLGMGMNYYVRYMGCIEVLQSMRSLDFGMRTQVTREAISRLCEAVSGANGAVKKRK
PPVKFLSTVLGKSNLQFSGMNIKLTISTCSLTLMNIDNQQIIANHHMQSISFASGGDPDT
TDYVAYVAKDPVNQRACHILECRSGMAQDVISTIGQAFELRFKQYLKNPSLNTSCESEEV
PLDGPAVEREDHEYYNEIPGKQPPAGGVSDVRIKDQATEQMAYCPIRCEKLCYLPGNSKC
SSVYENCLEQSRAIGNAQERGGQCQRDAALMKHTCRVDFLNDPCYINTQGLQSTLGSSPN
QSSAHSLGSPWHRQKAPETVQPGATAQPASSHSLPHIKQQLRNEDCYHGKLSRKAAESLL
VKDGDFLVRESATSPGQYVLSGLQGGQAKHLLLVDPEGKVRTKDHVFDNVGHLIRYHMDN
SLPIISSGSEVSLKQPVRKDNNPGLLHSNK
NT seq 1893 nt NT seq  +upstreamnt  +downstreamnt
atgcgaaaacgcggtcaggacagcctggcaggacttgtgctgtatgtaggactcttcggg
caccccgggatgctgcacagggccaagtacagccgttttcggaatgagtccatcacgtcc
ttggacgaaagcagccccggaggctcagtggggagcaagggctcggcgcctcctccctac
cccaccctggcacctcacctgccggctgaagatgccaccttggcgtcccaggagagcccc
accccattgtgcaccttgatccctcgcatggccagcgtgaagttggccaacccagccacc
ttgctgagtctgaaaaacttttgcttgggtaccaaagaggtgccccggctgaagctccag
gaaagccaggacccggcacccagcagcccagcttcccctgaaaccagtccaaatagggct
ggctctgcacctctgccgcaaccagacctgctggggcacagggcagctgccttaactccc
gatgcctgcccccttcctggccctggggagccaaccccagggagcaggcaggacaggcac
tttctgcagcacctgttggggatgggcatgaactactatgtgaggtacatgggctgtatc
gaagtgctacagtcaatgaggtcactggattttggaatgagaacgcaagttacaagggaa
gcaataagtcgcctgtgtgaagctgtctctggggcaaatggagccgttaaaaagcgaaag
cctccagttaagttcctatcaacagttcttggcaaaagtaatcttcagttttcgggaatg
aatattaaactgaccatctcaacatgcagcctcacgttgatgaatattgacaaccaacag
attattgcaaatcatcatatgcagtctatttcatttgcctctggaggggatcctgatact
acagactatgttgcctacgtagctaaagatccagttaatcaacgagcctgccacatattg
gaatgccgcagcggaatggcccaagatgtcatcagcaccatagggcaggcttttgaactc
cggtttaaacagtatttgaaaaatccttctttgaatacttcttgtgaaagtgaggaggtg
cctcttgatggtcctgctgtggagagagaagatcatgagtattacaatgaaatcccaggg
aagcagccacctgcaggtggtgtttcagatgtgcgcatcaaagaccaagccacagaacag
atggcttactgccccatacggtgtgaaaagttgtgctatctgcctggaaactccaagtgc
agcagtgtgtacgagaactgtttagaacaaagcagggcaataggtaacgcacaggagaga
ggagggcagtgccaacgagatgccgcattgatgaagcacacgtgtcgagtggatttcctc
aatgacccctgctacataaatacacagggtcttcaaagtacacttggctcttccccaaat
caaagctcagctcactccctggggagcccgtggcaccgtcagaaagcaccagaaactgtt
cagccaggtgccacggcccagcctgccagctcacattctttgccacacattaagcagcag
ctgcggaatgaagactgctaccatggcaagctgagcaggaaggcagcagagagcctcttg
gtaaaggatggggactttttggttcgagaaagtgcaacatctcctggtcagtatgtgcta
agtggacttcagggaggccaggcaaagcatcttctcctggtggatcctgaaggcaaggta
aggaccaaggatcatgtgtttgataatgttggccaccttatcagataccacatggataat
agtttgccaatcatctcttctggaagtgaagtaagccttaaacagccagtgagaaaagat
aataatccaggacttctgcattccaacaaatga

DBGET integrated database retrieval system