KEGG   Felis catus (domestic cat): 101083682Help
Entry
101083682         CDS       T02385                                 

Gene name
TNFAIP3
Definition
(RefSeq) tumor necrosis factor alpha-induced protein 3
  KO
K11859  tumor necrosis factor, alpha-induced protein 3 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04217  Necroptosis
fca04621  NOD-like receptor signaling pathway
fca04657  IL-17 signaling pathway
fca04668  TNF signaling pathway
fca05162  Measles
fca05169  Epstein-Barr virus infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04064 NF-kappa B signaling pathway
    101083682 (TNFAIP3)
   04668 TNF signaling pathway
    101083682 (TNFAIP3)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    101083682 (TNFAIP3)
 09150 Organismal Systems
  09151 Immune system
   04621 NOD-like receptor signaling pathway
    101083682 (TNFAIP3)
   04657 IL-17 signaling pathway
    101083682 (TNFAIP3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05162 Measles
    101083682 (TNFAIP3)
   05169 Epstein-Barr virus infection
    101083682 (TNFAIP3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:fca01002]
    101083682 (TNFAIP3)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fca04121]
    101083682 (TNFAIP3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101083682 (TNFAIP3)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C64
   101083682 (TNFAIP3)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   OTU
    101083682 (TNFAIP3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-A20 OTU
Motif
Other DBs
NCBI-GeneID: 101083682
NCBI-ProteinID: XP_006932110
Ensembl: ENSFCAG00000008135
UniProt: A0A2I2UZV8
Position
B2
AA seq 790 aa AA seqDB search
MAEQLLPQALYLSNMRKAVKIRERTPEDIFKPTNGIIHHFKSMHRYTLEMFRTCQFCPQF
REIIHKALIDRTIQASLESQKKLNWCREVRKLVALKTNGDGNCLMHAASQYMWGVQDTDL
VLRKALFSTLKETDTRNFKFRWQLESLKSQEFVETGLCYDTRNWTDEWDSLVKMASTDTP
MARGGLQYNSLEEIHIFVLCNILRRPIIVISDKMLRSLESGSNFAPLKVGGIYLPLHWPA
QECYRYPIILGYDSQHFVPLVTLKDSGPEIRAVPLVNRERGRFEDLKVHFLTDPENEMKE
KLLKEYLMVIEIPVQGWDHGTTHLINAAKLDEANLPKEINLVDDYFELVQHEYKKWQENS
EQERREAHAQNPLEPSVPQLSLMDVKCETPNCPFFMSVNTQPLCHECSERRQNNHTKSSK
LHSKPGPEGLPGVAAGASRGEAYEPGGWSPEEPTGGPHSAPPTAPSLFLFSETTAMKCRS
PGCPFTLNVQHNGFCERCHQARQLNGGHTSDSMRHLDPGKCRACLQDVTRTFNGICSTCF
KRTTAEPSSGLSSSVPPSCHQRSKSDPSQLIQSLSPHSCRRAGTEAPSGCLSQAPRTPGD
RTGTSKCRKAGCMYFGTPENKGFCTLCFIEYRENKHFVAASTKASPTAPRFQNAVPCLGR
ECGTLGSTVFEGYCQKCFIEAQTQRFHEAKRTEEHLRSSQRRDVPRTTPSASRPKCARAS
CKNILACRSEELCMECQHLSQRAGPTPHRGEPAPEEPPKQRCRAPACDHFGNAKCNGYCN
ECFQFKQLYG
NT seq 2373 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaactccttccccaggctttgtatttgagcaacatgcggaaagctgtgaag
atacgagagagaactccagaagatatatttaagcctaccaacgggatcattcaccatttc
aaatccatgcaccggtacacgctggaaatgtttagaacttgccagttttgtccccagttt
cgggagatcatccacaaagcgctcattgacagaaccatccaggcctccctcgaaagccag
aagaagctgaactggtgtcgagaagtccggaagctggtggccctgaaaacgaacggcgat
ggaaactgcctcatgcacgctgcttcccagtacatgtggggtgttcaggacacagacttg
gtcctgaggaaggcactcttcagcactctcaaggagacagatacgcgcaactttaaattc
cgctggcagctggagtctcttaagtctcaggagtttgtggaaacggggctttgctacgac
actcggaattggaccgatgagtgggacagcctcgtcaaaatggcatccacagacacaccc
atggcccgaggcggacttcagtacaactcactggaagaaatacacatctttgtcctttgc
aacatactcagaaggccgatcattgtcatttcagacaaaatgctgagaagtctggaatcg
ggttccaatttcgctcctttgaaggtgggcgggatttacctgcctctccactggccggct
caagaatgctaccgataccccatcattctcggctacgacagccagcactttgtacccctg
gtgaccctgaaggacagcggacctgaaatccgagctgttccacttgttaacagagagcga
ggaagatttgaagacttaaaagttcactttttgaccgatcctgaaaacgagatgaaggaa
aagctcttgaaagagtacttgatggtgatcgaaatccccgtccaaggctgggaccacggc
accacccatttgatcaatgctgcaaagctggatgaagctaacttaccaaaagaaataaac
ttggtagatgattactttgaactcgtccagcacgagtacaagaagtggcaggagaacagt
gagcaagagcggagagaggcgcatgctcagaaccctttggaaccttccgtgccccagctc
tccctcatggacgtaaaatgtgaaacgcccaactgtcctttcttcatgtccgtgaacacc
cagcctttgtgccacgagtgctccgagaggcggcaaaacaaccacaccaagtcctcaaag
ctgcactccaagccgggccccgaggggctcccaggcgtggcggccggggcctcgcggggt
gaggcctacgagcccgggggctggagccccgaggagccgaccggggggcctcattcggcc
cctccgacggcgcccagccttttcctgttcagcgagaccaccgccatgaaatgcaggagc
cccggctgccctttcacgctgaacgtgcagcacaacggattctgtgagcggtgccaccag
gcccggcagcttaacgggggccacacctcggacagcatgaggcacttagaccccgggaag
tgccgagcctgcctgcaggatgtcaccaggacgtttaatggaatctgcagtacttgcttc
aaaaggactacggcggaaccctcctcgggcctcagctccagcgtccctccttcctgtcac
cagaggtccaagtcggacccctcgcagctcatccagagtctctccccacattcttgccgc
agagctgggaccgaggctccctctggctgcctctctcaggccccacggactccaggggac
aggacagggacgagcaagtgcagaaaagccggctgcatgtatttcgggactccagaaaac
aaaggcttctgtacgctgtgtttcatcgagtacagagaaaacaaacatttcgtcgccgct
tccacgaaggccagtcccacagcccccaggttccagaatgccgtcccctgcctggggagg
gaatgcggcaccctcggaagcaccgtgttcgaagggtactgccagaagtgtttcatcgaa
gcgcagacccagagatttcacgaggcgaaaaggactgaagagcacctgagatcgagccag
cgcagagacgtgcctcggaccacgccgagcgcctcgaggcccaagtgcgcccgggcctcc
tgcaagaacatcctggcctgccgcagcgaggagctctgcatggagtgccagcacctcagc
cagcgagcgggcccgacgccgcaccggggcgagccggcccccgaggagccgcccaagcag
cgctgccgcgcccccgcctgcgaccacttcggcaacgccaagtgtaacggctactgcaac
gagtgcttccagttcaagcagctgtacggctga

DBGET integrated database retrieval system