KEGG   Felis catus (domestic cat): 101083683Help
Entry
101083683         CDS       T02385                                 

Gene name
DLL1
Definition
(RefSeq) delta-like protein 1
  KO
K06051  delta
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca05200  Pathways in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101083683 (DLL1)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101083683 (DLL1)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101083683 (DLL1)
  09162 Cancer: specific types
   05224 Breast cancer
    101083683 (DLL1)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101083683 (DLL1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF MNNL hEGF DSL EGF_CA EGF_2 EGF_3
Motif
Other DBs
NCBI-GeneID: 101083683
NCBI-ProteinID: XP_023110399
Ensembl: ENSFCAG00000004661
Position
B2
AA seq 725 aa AA seqDB search
MGRRCALALAVVSALLCQVWTSGVFELKLQEFVNKKGLLGNRNCCRGGAGPPPCACRTFF
RVCLKHYQASVSPEPPCTYGSAVTPVLGVDSFSLPEGAGADPAFSNPIRFPFGFTWPGTF
SLIIEALHTDSPDDLTTENPERLISRLATQRHLTVGEEWSQDLHSSGRTDLKYSYRFVCD
EHYYGDGCSVFCRPRDDAFGHFTCGERGEKVCDPGWKGQYCTEPICLPGCDELHGFCDKP
GECKCRVGWQSRYCDQCIRYPGCLHGTCQQPWQCNCQEGWGGLFCNQDLNYCTHHKPCRN
GATCTNTGQGSYTCSCRPGYSGANCETEIDECGASPCRNGGSCTDLENGYSCTCPPGFYG
RICELSAMACADGPCFNGGRCSDNPEGGYTCRCPVGFSGFNCEKKVDSCSSSPCSHGAQC
VDLGDAYLCRCQAGFSGRRCEDNVDDCASSPCANGGTCRDGVNEYSCTCPPGYTGRNCSA
PVSRCEHAPCHNGATCHERDRRYLCECARGYGGPNCQFLLPEPPPGPAVVVDLTEKYVEG
QAGPFPWVAVCAGVVLVLMLLLGCAAAVVCVRLRLQKDRPPAEPCRGEAETMNNLANCQR
EKDICVSVIGATQIKNTNKKVDFHGDHGADKNGLKARYPAVDYNLVQDLKGDAAAAVRDP
HGKRDAKGQPQGSAGEEKSTPTLRGGEAPERKRPDSVYSTSKDTKYQSVYVISEEKDECV
IATEV
NT seq 2178 nt NT seq  +upstreamnt  +downstreamnt
atgggccgccggtgcgccctggccctcgccgtggtgtcggccctgctgtgccaggtctgg
acctccggggtgttcgagctgaagcttcaggagttcgtcaacaagaaggggctgctggga
aaccgcaactgctgccgcgggggcgcggggccgccgccgtgcgcctgcaggaccttcttc
cgcgtgtgcctcaagcactatcaggccagcgtgtctcctgagccaccctgtacctacggc
agcgccgtcacgccggtgctgggcgtggactccttcagcctgcccgaaggcgcgggcgcc
gaccccgcctttagcaaccccatccgcttccccttcggctttacctggccgggcaccttc
tcgctgatcattgaagcccttcacacagattctcctgatgacctcacaacagaaaaccca
gaaagactcatcagccgcctggccacgcagaggcacctgactgtgggcgaggagtggtct
caggacctgcacagcagcggccgaacagacctcaagtattcctaccgctttgtgtgtgac
gagcactactatggggacggctgctccgtcttctgtcgcccccgagacgacgccttcggc
cacttcacctgcggggagaggggggaaaaagtctgcgatcctggctggaaaggccagtac
tgcactgaaccaatctgcttgccaggatgcgacgagctgcatgggttttgtgacaagcca
ggggagtgcaagtgcagagtgggctggcagagccggtactgtgaccagtgcatccggtac
ccaggctgcctccacggcacctgccagcagccctggcagtgcaactgccaggagggctgg
ggtggcctcttctgcaaccaggacctgaactactgcacacaccacaagccctgcaggaac
ggggccacctgcactaacacgggccagggaagttacacctgctcttgccggccggggtac
tcaggggccaactgtgagacggagatcgacgagtgtggcgccagcccctgcaggaatgga
ggcagctgcacggatcttgagaatggctactcttgcacgtgcccacccggcttctacggc
agaatctgtgagctgagtgccatggcgtgtgccgacggcccctgcttcaacgggggacgg
tgctcagacaaccccgaaggagggtacacctgccgctgccccgtgggcttctccggcttt
aactgtgagaagaaggtggattcctgcagctcttcaccctgttctcatggtgcacagtgt
gtggaccttggtgatgcttacctgtgccgctgccaggctggcttctccgggaggcgctgc
gaagacaacgtggatgattgtgcctcctccccgtgtgccaacgggggcacctgccgggac
ggcgtgaacgagtactcctgcacctgtcccccaggttacacaggcaggaactgcagtgcc
cctgtcagcaggtgtgagcacgcgccctgccacaacggggccacctgccacgagagggac
cggcgttacctgtgtgagtgcgcccggggctacgggggccccaactgccagttcttgctg
cctgagccgcccccgggcccggcggtggtggtggacctcaccgagaagtacgtggagggc
caggccgggcccttcccctgggtggccgtctgtgccggcgtggtgcttgtcctcatgctg
ctgctgggctgtgccgccgccgtggtctgcgtgcggctcaggctgcagaaggaccggccc
cctgccgagccctgccgtggggaggcggagacgatgaacaacctggccaactgccagcgc
gagaaggacatctgcgtcagcgtcatcggggccacgcagatcaagaacaccaacaagaag
gttgacttccacggggaccacggggctgataagaacggtctcaaggcccgctaccctgct
gtggattataacctagtgcaggacctcaagggcgacgccgcggccgccgtcagggacccc
catggcaagcgtgacgccaagggccagccccagggctctgcaggggaggagaagagcacc
ccgacactcaggggtggagaagcacctgaaaggaaaagaccagactccgtgtattctact
tcaaaagacacaaagtaccagtcagtgtacgtcatatcggaggagaaagacgagtgcgtc
atagcgaccgaggtgtga

KEGG   Felis catus (domestic cat): 101086978Help
Entry
101086978         CDS       T02385                                 

Gene name
DLL4
Definition
(RefSeq) delta-like protein 4
  KO
K06051  delta
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca05200  Pathways in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101086978 (DLL4)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101086978 (DLL4)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101086978 (DLL4)
  09162 Cancer: specific types
   05224 Breast cancer
    101086978 (DLL4)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101086978 (DLL4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF DSL hEGF MNNL EGF_2 DUF4381 EGF_3 EGF_CA
Motif
Other DBs
NCBI-GeneID: 101086978
NCBI-ProteinID: XP_003987315
Ensembl: ENSFCAG00000014721
Position
B3
AA seq 685 aa AA seqDB search
MAAASRSAFSWALLLLVTLWQQRAAGSGVFQLQLQEFANERGVLASGRPCEPGCRTFFRV
CLKHFQAVVSPGPCTFGSVSTPVLGTNSFAVGDDSSGGGRNPLQLPFNFTWPGTFSLIIE
AWHAPGDDLRPEALPPDALISKIAIQGSLAVGKNWLLDEQTSPPTRLRYSYRVICSDNYY
GDSCSRLCKKRNDHFGHYVCQPDGSLSCLPGWTGEYCEQPVCLSGCHEQNGYCSKPAECI
CRPGWQGRLCNECIPHNGCRHGTCSIPWQCTCDEGWGGLFCDQDLNYCTHHSPCKNGATC
SNSGQRSYTCTCRPGYTGVDCELELSECDSNPCRNGGSCKDQEDGYRCLCPPGYYGLHCE
HSTLSCADSPCFNGGSCRERNQGASYACECPPNFMGSNCEKKVDRCTSNPCANGGQCVNR
GPNRMCRCRPGFTGLHCELPISDCARSPCAHGGTCHDLENGLMCTCPAGFSGRRCEVPIP
GDACVSGPCFNGATCYPGLSRDSFVCNCPYGFVGSRCEFPMSMPPSFPWVAVSLGVGLVV
VLVLLGMVAVAVRQLRLRRPEDGGREAMNNLSDFQKDNLIPAAQLKNTNQKKELEVDCGL
DKSNCGKQQNHTLDYNLAPGPLGRGTMAGKYSHSDKSLGEKAPLRLHSEKPECRISAICS
PRESMYQSVCLISEERNECVIATEV
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atggcagccgcgtcccgtagcgcctttagctgggcgctactgctgctggtgacactttgg
cagcagcgcgcagccggctccggagtctttcagctgcagctgcaggagtttgccaacgag
cgcggcgtactggctagcgggcggccgtgcgaacccggctgcaggaccttcttccgcgtc
tgccttaagcacttccaggcggtcgtctcgcccgggccctgcacctttggcagcgtctcg
acgcctgtgttgggcaccaactccttcgccgtcggggatgatagtagcggcgggggacgc
aaccctcttcaactccctttcaatttcacctggccgggtaccttctcactcatcattgaa
gcttggcacgcgccaggagacgacctgaggccagaggctttgccaccagacgcgcttatc
agcaagatcgccatccagggctccctagctgtgggcaagaactggttattggacgagcag
accagccctcccactaggctgcgctactcttaccgggtcatctgcagtgacaactactat
ggggacagctgctcacgcctgtgcaagaagcgtaatgaccacttcggccactacgtgtgc
cagccagatggcagcctgtcctgcctacccggctggactggggagtactgcgaacagcct
gtctgtctttctggctgtcatgaacagaatggttactgcagcaagccagcagaatgcatc
tgccgcccaggctggcagggacgcctgtgcaacgagtgcatcccccacaatggctgtcgc
catggcacctgcagcatcccctggcaatgcacctgtgatgagggctgggggggcctattc
tgtgaccaagatctcaattactgcacccaccactctccatgcaagaacggggcaacgtgc
tccaacagtgggcagcggagctacacctgcacctgtcgcccaggctacactggcgtggac
tgtgaactggagctcagcgagtgtgatagcaacccttgtcgcaatggaggcagctgtaag
gaccaggaggatggctaccgctgcctgtgtcccccgggctactatggcttgcactgtgaa
cacagcactttgagctgtgcagactcaccctgcttcaatgggggctcttgccgggagcgc
aaccagggggccagctatgcctgtgaatgcccccccaacttcatgggctccaactgtgag
aagaaggtggacaggtgtaccagcaacccatgtgccaatgggggccagtgcgtgaaccgt
ggtccgaaccgcatgtgccgctgccgtcctggattcacaggcctccactgtgaactcccc
atcagcgactgtgcccgcagcccttgtgcccacggcggcacttgccatgatctagagaat
gggctcatgtgcacctgccctgctggtttctctggccggcgctgcgaggtgcctattcct
ggtgacgcctgtgtctcaggaccctgcttcaatggggccacctgctaccctggcctctcc
cgggacagcttcgtctgcaactgtccctatggctttgtgggcagccgctgcgagttccct
atgagcatgccacccagcttcccctgggtggctgtctctctgggcgtgggactggtggtg
gtgctggtgttgctgggcatggtggcagtggcagtgcggcagctgcgacttcggcggcct
gaagatggtggcagggaggccatgaacaacttgtcagacttccagaaggacaacctgatc
cctgcagcccagctcaagaacacaaaccagaagaaggagctggaagtggactgtggcctg
gacaagtccaactgtggcaaacaacagaaccacacactggactataatctggccccgggg
cctctggggcgagggaccatggcggggaagtattcccacagtgataagagcttaggggag
aaggcgccactgaggttacacagtgaaaagccagagtgtcggatatcagcgatatgctcc
cccagggaatccatgtaccagtctgtgtgtttgatatcagaagagaggaacgaatgtgtc
attgccacagaggtataa

KEGG   Felis catus (domestic cat): 101095456Help
Entry
101095456         CDS       T02385                                 

Gene name
DLL3
Definition
(RefSeq) delta-like protein 3
  KO
K06051  delta
Organism
fca  Felis catus (domestic cat)
Pathway
fca01522  Endocrine resistance
fca04330  Notch signaling pathway
fca04658  Th1 and Th2 cell differentiation
fca05200  Pathways in cancer
fca05224  Breast cancer
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101095456 (DLL3)
 09150 Organismal Systems
  09151 Immune system
   04658 Th1 and Th2 cell differentiation
    101095456 (DLL3)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101095456 (DLL3)
  09162 Cancer: specific types
   05224 Breast cancer
    101095456 (DLL3)
  09176 Drug resistance: antineoplastic
   01522 Endocrine resistance
    101095456 (DLL3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EGF hEGF EGF_2 EGF_CA DSL Plasmod_Pvs28
Motif
Other DBs
NCBI-GeneID: 101095456
NCBI-ProteinID: XP_003997855
Ensembl: ENSFCAG00000010746
UniProt: M3WDU9
Position
E2
AA seq 589 aa AA seqDB search
MVSPQMAQLLSRTVILALLFLPQAGPAGVFELQIHSFGPGPGPGAPRSPCSAQGPCRLFF
RVCLKPGVSEEAGESPCALGAALSARGPVYTQQPGAPAPDLPLPDGFMRVPFREAWPGTF
SLIIETWREELEQIGGPAWSLLARVAGRRRLAAGGPWARDVQRAGAWELRFSYRARCEPP
AVGAACARLCRSRSAPSRCGPELRPCAPVEDECEAAPACRAGCSPDHGFCEQPNECRCLE
GWTGPLCTIPVSSSCLTPRGPSSAATGCLVPRPGPCDGNPCANGGSCSETSGSFECACPR
GFYGLRCEVSGVTCADGPCFNGGLCVGGADPDSAYVCHCPPGFQGSNCEKRVDRCSLKPC
RNGGLCLDLGHALRCRCRAGFAGPRCEHDLDDCTGRACANGGTCLEGGGARRCSCALGFG
GRDCRERADPCAARPCAHGGRCYAHFSGLVCACAPGYMGARCEFPVHPVGVDDGTGALPA
ALPGLRQGDPQRFLLPPALGLLVAAGLAGTALLLVHVRRRGPVRDTGSRLLAGTPEPSVH
ALPDALNNRRTQEGSEDGPSQPADWSHPEDGDSRAIYVISAPSIYAREA
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcccgcagatggcccagctcctgtcccggacggtgatcctggcgcttcttttc
cttccccaggcagggccggcaggcgtcttcgagctgcagatccactcttttgggccggga
ccaggcccgggggccccgcggtccccttgcagcgcccagggcccgtgccgcctcttcttt
agggtctgcctgaagccaggggtctccgaagaggccggcgaatctccgtgcgccctgggc
gcggcgctgagtgcgcgcggaccggtctatacccagcagcctggagcgccggcgcctgac
ctgccgctgcccgacggcttcatgcgcgtgcccttccgggaagcctggccgggcaccttc
tctctcatcatcgaaacctggagagaagagttagaacagattggcggacccgcctggagc
cttctggcgcgcgtggccggccggcgccgcctagcggccgggggcccgtgggcgcgggat
gtgcagcgcgcaggcgcctgggaactacgtttctcctaccgcgcgcgctgcgagccgccc
gccgtcggggccgcatgcgcgcgcctctgccgctcgcgcagcgccccctcgcggtgcggc
ccagaattgcgcccctgcgcgccggtcgaggacgagtgcgaggcagcgccggcatgtcgg
gccggctgcagtccagaccacggcttctgtgagcagcccaatgaatgtcgatgcctggag
ggctggactgggcccctctgcaccatccccgtctccagcagctgcctcactcccaggggc
ccatcctctgctgccactggatgccttgtacccaggcctgggccctgtgatgggaaccca
tgtgccaacgggggtagctgcagtgagacatcaggatccttcgaatgcgcctgtccccgc
gggttctacggattgcggtgtgaggtgagcggggtgacgtgtgcggatggaccttgcttc
aatggcggcttgtgtgtgggaggcgcagaccctgactctgcctacgtctgccactgtcca
cccggtttccaaggctccaactgtgagaagagagtggaccggtgcagcctgaaaccgtgc
cggaacggcgggctctgcctggacctgggccacgccctgcgctgccgctgccgcgccggc
ttcgcggggccgcgctgcgagcacgacctggacgactgcaccggccgcgcctgcgccaac
ggcggcacgtgcctggagggtggtggcgcgcgacgctgctcctgcgccctgggcttcggc
ggccgagactgccgcgagcgcgccgacccgtgtgccgcgcgcccctgcgcccacggcggc
cgctgctacgcccacttctccggcctcgtctgcgcctgcgcgcccggctacatgggcgcg
cgctgcgagtttccggttcaccccgtcggcgtggacgacggcacaggcgcgttacccgcg
gccctaccagggctgaggcagggggatccccagcgcttccttttgcccccggctctggga
ctgctggtggccgcgggcttggccggcactgcgctcttgctggtccacgtgcgacgccgt
ggtcctgtccgggatactgggtctcgcttgctggcggggaccccggagccatcggtgcat
gcgctaccagacgcactcaacaaccggagaacgcaggagggttccgaggatggcccgagc
cagcccgcggactggagtcaccccgaagatggagactctcgtgcgatttacgtcatatct
gcgccttccatctatgcccgggaggcctga

DBGET integrated database retrieval system