KEGG   Felis catus (domestic cat): 101083845
Entry
101083845         CDS       T02385                                 

Gene name
DCK
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00230  Purine metabolism
fca00240  Pyrimidine metabolism
fca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    101083845 (DCK)
   00240 Pyrimidine metabolism
    101083845 (DCK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     101083845 (DCK)
SSDB
Motif
Pfam: dNK AAA_18 Thymidylate_kin AAA_28 AAA_33 AAA_17 CoaE
Other DBs
NCBI-GeneID: 101083845
NCBI-ProteinID: XP_003985344
Ensembl: ENSFCAG00000022606
UniProt: M3X133
Position
B1
AA seq 269 aa
MHSDHHQTRMATPPKRSCPSPATGFEGVRIKKIAIEGNIASGKTTFVNILKQVCEDWEVV
PEPVARWCNVQSAQDDCEELTPSQKSGGNVLQMMYEKPERWSFTFQSYACLSRIRAQLAC
LNGKLKDAEKPVLFFERSIYSDRYVFASNLYESDCMNETEWTIYQDWHDWMNHQFGQSLE
LDGIIYLRATPEKCLNRMYLRGRNEEQGIPLEYLEKLHDKHESWLLHRTLKTDFDFLQEI
PILTLDINEDFKDKHDSLVEKVKEFLSTL
NT seq 810 nt   +upstreamnt  +downstreamnt
atgcactcggaccaccaccagactagaatggccaccccacctaagaggagctgcccgtct
cccgcgaccggctttgagggggtccgcatcaagaagattgccatcgaagggaacattgct
tcagggaagacaacatttgtgaatatccttaaacaggtctgtgaggattgggaagtggtt
cctgaacctgttgccagatggtgcaatgttcaaagtgcacaagatgactgtgaggaactg
acaccgtctcagaaaagtggtgggaatgttcttcaaatgatgtatgagaaacctgaacga
tggtcttttaccttccagtcatatgcctgcctcagtcgaatacgagcccagcttgcctgt
ctcaatggcaagctcaaagatgcagagaaacctgtattattttttgaacgatctatatat
agtgacaggtatgtttttgcatctaatttgtatgaatctgactgcatgaatgaaacggag
tggacaatttatcaagactggcatgactggatgaatcaccagtttggtcaaagccttgaa
ctggatggaatcatttatcttcgagccacaccagagaaatgcttgaatagaatgtattta
cggggaagaaatgaagaacaaggcattcctcttgagtatttagagaagcttcacgataag
catgagagctggctcctgcatagaaccctgaaaaccgactttgattttctacaagaaatc
cccatcttaacactggatattaatgaagactttaaagacaaacacgacagtctagttgaa
aaggtcaaagaatttttgagcactttgtga

DBGET integrated database retrieval system