KEGG   Felis catus (domestic cat): 101084011Help
Entry
101084011         CDS       T02385                                 

Gene name
RHOA
Definition
(RefSeq) transforming protein RhoA
  KO
K04513  Ras homolog gene family, member A
Organism
fca  Felis catus (domestic cat)
Pathway
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04022  cGMP-PKG signaling pathway
fca04024  cAMP signaling pathway
fca04062  Chemokine signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04150  mTOR signaling pathway
fca04270  Vascular smooth muscle contraction
fca04310  Wnt signaling pathway
fca04350  TGF-beta signaling pathway
fca04360  Axon guidance
fca04510  Focal adhesion
fca04520  Adherens junction
fca04530  Tight junction
fca04611  Platelet activation
fca04621  NOD-like receptor signaling pathway
fca04625  C-type lectin receptor signaling pathway
fca04660  T cell receptor signaling pathway
fca04670  Leukocyte transendothelial migration
fca04722  Neurotrophin signaling pathway
fca04810  Regulation of actin cytoskeleton
fca04921  Oxytocin signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca04972  Pancreatic secretion
fca05100  Bacterial invasion of epithelial cells
fca05133  Pertussis
fca05152  Tuberculosis
fca05163  Human cytomegalovirus infection
fca05200  Pathways in cancer
fca05203  Viral carcinogenesis
fca05205  Proteoglycans in cancer
fca05206  MicroRNAs in cancer
fca05210  Colorectal cancer
fca05418  Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101084011 (RHOA)
   04015 Rap1 signaling pathway
    101084011 (RHOA)
   04310 Wnt signaling pathway
    101084011 (RHOA)
   04350 TGF-beta signaling pathway
    101084011 (RHOA)
   04072 Phospholipase D signaling pathway
    101084011 (RHOA)
   04071 Sphingolipid signaling pathway
    101084011 (RHOA)
   04024 cAMP signaling pathway
    101084011 (RHOA)
   04022 cGMP-PKG signaling pathway
    101084011 (RHOA)
   04150 mTOR signaling pathway
    101084011 (RHOA)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101084011 (RHOA)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    101084011 (RHOA)
   04520 Adherens junction
    101084011 (RHOA)
   04530 Tight junction
    101084011 (RHOA)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    101084011 (RHOA)
 09150 Organismal Systems
  09151 Immune system
   04611 Platelet activation
    101084011 (RHOA)
   04621 NOD-like receptor signaling pathway
    101084011 (RHOA)
   04625 C-type lectin receptor signaling pathway
    101084011 (RHOA)
   04660 T cell receptor signaling pathway
    101084011 (RHOA)
   04670 Leukocyte transendothelial migration
    101084011 (RHOA)
   04062 Chemokine signaling pathway
    101084011 (RHOA)
  09152 Endocrine system
   04921 Oxytocin signaling pathway
    101084011 (RHOA)
   04928 Parathyroid hormone synthesis, secretion and action
    101084011 (RHOA)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    101084011 (RHOA)
  09154 Digestive system
   04972 Pancreatic secretion
    101084011 (RHOA)
  09156 Nervous system
   04722 Neurotrophin signaling pathway
    101084011 (RHOA)
  09158 Development
   04360 Axon guidance
    101084011 (RHOA)
 09160 Human Diseases
  09161 Cancer: overview
   05200 Pathways in cancer
    101084011 (RHOA)
   05206 MicroRNAs in cancer
    101084011 (RHOA)
   05205 Proteoglycans in cancer
    101084011 (RHOA)
   05203 Viral carcinogenesis
    101084011 (RHOA)
  09162 Cancer: specific types
   05210 Colorectal cancer
    101084011 (RHOA)
  09166 Cardiovascular disease
   05418 Fluid shear stress and atherosclerosis
    101084011 (RHOA)
  09171 Infectious disease: bacterial
   05133 Pertussis
    101084011 (RHOA)
   05152 Tuberculosis
    101084011 (RHOA)
   05100 Bacterial invasion of epithelial cells
    101084011 (RHOA)
  09172 Infectious disease: viral
   05163 Human cytomegalovirus infection
    101084011 (RHOA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101084011 (RHOA)
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fca04147]
    101084011 (RHOA)
   04031 GTP-binding proteins [BR:fca04031]
    101084011 (RHOA)
Membrane trafficking [BR:fca04131]
 Endocytosis
  Lipid raft mediated endocytosis
   RhoA-dependent endocytosis
    101084011 (RHOA)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101084011 (RHOA)
  Exosomal proteins of other body fluids (saliva and urine)
   101084011 (RHOA)
  Exosomal proteins of colorectal cancer cells
   101084011 (RHOA)
  Exosomal proteins of bladder cancer cells
   101084011 (RHOA)
GTP-binding proteins [BR:fca04031]
 Small (Monomeric) G-proteins
  Rho Family
   RhoA/B/C [OT]
    101084011 (RHOA)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ras Roc Arf GTP_EFTU SRPRB Gtr1_RagA
Motif
Other DBs
NCBI-GeneID: 101084011
NCBI-ProteinID: XP_023104555
Ensembl: ENSFCAG00000027456
Position
A2
AA seq 193 aa AA seqDB search
MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVELALWDT
AGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILVGNKKD
LRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFEMATRAALQ
ARRGKKKSGCLVL
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atggctgccatccggaagaaactggtgattgttggtgatggagcctgtggcaagacttgc
ttgctcatcgtcttcagcaaggaccagttcccagaggtgtatgtacccacagtgtttgag
aactatgtggcagatattgaagttgatggaaagcaggtagagttggctttgtgggataca
gctgggcaggaagattatgatcgcttgaggcctctctcctatccggacactgatgttata
ctgatgtgtttctccattgacagccctgatagtttagaaaacatcccagaaaaatggact
ccggaagtcaagcacttctgtcccaatgtgcccatcattctggttggaaacaagaaggat
cttcggaatgatgagcacacaaggcgggagctggccaagatgaagcaggagccggtgaaa
ccagaagaaggcagagatatggcaaacaggattggtgcttttgggtacatggagtgttca
gcaaagaccaaagatggagtgagggaggtttttgaaatggccacgagagccgctctgcaa
gccagacgtgggaagaaaaaatctgggtgccttgtcttgtga

DBGET integrated database retrieval system