KEGG   Felis catus (domestic cat): 101084052Help
Entry
101084052         CDS       T02385                                 

Gene name
PLD1
Definition
(RefSeq) phospholipase D1 isoform X3
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca01100  Metabolic pathways
fca04014  Ras signaling pathway
fca04024  cAMP signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04912  GnRH signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101084052 (PLD1)
   00565 Ether lipid metabolism
    101084052 (PLD1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101084052 (PLD1)
   04072 Phospholipase D signaling pathway
    101084052 (PLD1)
   04071 Sphingolipid signaling pathway
    101084052 (PLD1)
   04024 cAMP signaling pathway
    101084052 (PLD1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101084052 (PLD1)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101084052 (PLD1)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101084052 (PLD1)
   04928 Parathyroid hormone synthesis, secretion and action
    101084052 (PLD1)
  09156 Nervous system
   04724 Glutamatergic synapse
    101084052 (PLD1)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101084052 (PLD1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101084052 (PLD1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     101084052 (PLD1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101084052 (PLD1)
 Endosome - Golgi transport
  Others
   Others
    101084052 (PLD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PLDc_2 PLDc PH DUF3785
Motif
Other DBs
NCBI-GeneID: 101084052
NCBI-ProteinID: XP_003991956
UniProt: A0A2I2UYK1
Position
C2
AA seq 1074 aa AA seqDB search
MSLKNEPRVNTSALQKIAADMSNLIENLDTRELHFEGEEVDYDVSPSDPKIQEVCIPFSA
IYKTQGFKEPNIQTYLTGCPIKAQVLEVERFTSTTRVPSINLYTIELTHGEFKWQVKRKF
KHFQEFHRELLKYKAFIRIPIPTRRHTFRRQNVKEEPREMPSLPRSSENMIREEQFFGRR
KQLEDYLTKLLKMPMYRNYHATTEFLDISQLSFIHDLGPKGIEGMIMKRSGGHRIPGLNC
CGQGRACYRWSKRWLIVKDSFLLYMKPDSGAIAFVLLVDKEFKIKVGKKETETKYGLRID
NLSRTLILKCNSYRHARWWGGAIEEFIQKYGTNFLKDHRFGSYAAIQENTLAKWYVNAKG
YFEDVANAMEEAQEEIFITDWWLSPEIFLKRPVVEGNRWRLDCILKRKAQEGVRIFIMLY
KEVELALGINSEYSKRTLMRLHPNIKVMRHPDHVSSSVYLWAHHEKIVVIDQSVAFVGGI
DLAYGRWDDNEHRLTDVGSVKRVTVGPSLSSFTAETTESMESLSLQDKNKASNNLPTLRT
VDDTDSKLKGVGKSRKFSKFSLYRHLHRHHLHDADSISSIDSASSYCNHCRSRQNLIHGL
KPHLKLFHSSSKSEQGLTRPNVDTSSLRSLQTGMGELHGETRFWHGKDYCNFVFKDWVQL
DKPFADFIDRHSTPRMPWHDIASAVHGKAARDVARHFIQRWNFTKIMKSKYRSLSYPFLL
PKSQTTAHELKYQVPGSVHANVQLLRSAADWSAGIKYHEESIHTAYIHVIENSKHYIYIE
NQFFISCADDKVVFNKIGDAIAQRILKAHRENQRYRVYVVIPLLPGFEGDISTGGGNALQ
AIMHFNYRTMCRGENSILGQLKAKLGNQWINYISFCGLRTHAELEGNLVTELIYVHSKLL
IADDNTVIIGSANINDRSMLGKRDSEMAVIVQDTETVPSVMDGEEYQAGRFAQGLRLQSF
RVVLGYLSDPSENIQDPVSDKFFKEVWVATAARNATIYDKVFRCLPNDEVHNLIQLRDFI
SKPILAKEDPIRAEEELKKIRGFLVQFPFYFLSEENLLPSVGTKEAIVPTEVWT
NT seq 3225 nt NT seq  +upstreamnt  +downstreamnt
atgtcactgaaaaatgagccaagagtaaatacctctgcactgcagaaaatcgctgctgac
atgagtaatttgatagaaaatctggacacacgggagctgcactttgagggagaagaggtg
gattatgatgtgtctcccagcgatcccaagatacaggaagtgtgtattcctttctctgct
atttataagactcaaggatttaaggagcctaatatacagacgtatctcaccggctgtcca
ataaaagcccaagttctggaagtggagcgctttacatctacaacaagggtaccaagtatc
aatctttacactattgaattaacacatggggaatttaaatggcaagttaagaggaaattc
aaacactttcaagaatttcatagagagctgctcaagtacaaagcttttatccgaatcccc
attcccaccagaaggcacacgtttagaagacagaatgtcaaagaagagcctcgagagatg
ccaagtttgccccgctcatctgaaaacatgatcagagaagaacaattcttcggtagaagg
aaacaactggaagattatttgacaaagctactgaaaatgcccatgtatagaaactaccat
gcaacaacagaattccttgacataagccagctgtctttcatccatgatttgggaccaaag
ggcatagaaggtatgataatgaagagatccgggggacacagaataccaggcttgaattgc
tgtggtcagggaagagcctgctaccgctggtcaaaaaggtggttgatagtgaaagattcc
tttttactgtatatgaaaccagacagtggtgccattgccttcgtcctgctggtagataaa
gaattcaaaatcaaggtggggaagaaggagacagagacaaaatacgggctccgaattgat
aatctttcaaggactcttattttaaaatgcaacagctatagacatgctcggtggtgggga
ggggctatagaagaattcatccagaaatatggtaccaactttctcaaagaccatcgattc
gggtcctatgctgctatccaggagaatacattagccaaatggtacgttaatgccaaagga
tattttgaagatgtggcaaatgcaatggaagaggcacaagaagagatttttatcacggat
tggtggttgagtccagaaatcttcctgaaacgcccggtggttgaaggaaatcgttggagg
ttggactgcattcttaaacgaaaagcacaagagggggtgagaatcttcataatgctctac
aaagaggtggaactcgctcttggaatcaatagtgaatacagcaagaggactttaatgcgt
ctacaccccaacataaaggtgatgaggcacccagatcatgtatcatccagcgtgtatctg
tgggctcatcatgagaaaattgttgtcattgaccagtcagtggcttttgtgggtgggatc
gacctggcctatggaaggtgggatgacaacgaacacagactcacggacgtgggcagcgtg
aagcgtgtcactgtaggaccatctctgagttccttcacagctgaaacaacagagtccatg
gaatccttaagccttcaagataaaaacaaagctagtaacaatctgcccaccctgaggacc
gttgatgatacggattcaaaactgaaaggagtaggaaaatccagaaagttctcgaaattt
agcctctacagacatctccacaggcaccacctgcacgatgcagacagcatcagcagcatc
gacagtgcctctagttattgtaatcactgtagaagtcgtcagaatttaatccatggttta
aaaccccacctgaaactctttcactcttccagtaagtctgaacagggactcactagacct
aatgttgacaccagctccctccgcagtttacagacaggcatgggagagctccatggggaa
accaggttctggcatggaaaggactactgcaattttgtcttcaaagactgggttcaactt
gataaaccttttgctgatttcattgacaggcactccactccccggatgccatggcatgac
attgcctctgcagttcacgggaaggcagctcgtgacgtagcacgtcacttcatccagcgc
tggaacttcacgaagataatgaaatcaaagtatcggtccctttcgtacccttttctgctt
ccaaaatctcaaacaacagcccatgagctgaaatatcaagtgcctgggtctgtccatgcc
aatgtacagttgctccgctctgctgctgattggtcggctggtataaagtaccatgaagag
tccatccatactgcttatatccatgtgatagagaacagcaagcactatatctacatagag
aaccagtttttcataagttgtgctgatgacaaagttgtgttcaacaagataggtgatgcc
attgctcagaggatcctgaaagctcacagggaaaaccagagataccgggtgtatgttgtg
ataccgctgctgccaggatttgaaggagacatttcaacgggtggaggaaatgctctgcag
gcaataatgcacttcaactacagaaccatgtgcagaggagaaaattccatccttgggcag
ttaaaagcaaagcttggcaatcagtggataaattacatatcattctgtggccttagaacg
catgcagagcttgaaggaaacctagtcactgagctcatctatgtccacagcaagttgcta
attgctgatgacaacactgttattattggctctgccaacataaacgaccgaagcatgctg
gggaagcgtgacagtgaaatggctgtcattgtacaggacacagagacagtcccttcagta
atggatggggaagaataccaagctggccggttcgcccaaggacttcggctgcagagcttc
agggttgtccttggctatctttctgacccaagcgaaaacattcaggatccagtgagtgac
aaattcttcaaggaggtatgggttgcaacggcagctcgaaatgctacaatttatgataag
gtgttccggtgccttcccaatgatgaagtacacaatttaattcaattgagagactttatt
agcaagcccatattagcaaaggaggatcccattagagccgaggaagaactgaaaaagatc
cgtgggttcttggtgcaattccccttttatttcttgtctgaagaaaacctactgccttcc
gttggaaccaaagaagccatagtgcccacagaggtttggacttaa

KEGG   Felis catus (domestic cat): 101092214Help
Entry
101092214         CDS       T02385                                 

Gene name
PLD2
Definition
(RefSeq) phospholipase D2
  KO
K01115  phospholipase D1/2 [EC:3.1.4.4]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
fca00565  Ether lipid metabolism
fca01100  Metabolic pathways
fca04014  Ras signaling pathway
fca04024  cAMP signaling pathway
fca04071  Sphingolipid signaling pathway
fca04072  Phospholipase D signaling pathway
fca04144  Endocytosis
fca04666  Fc gamma R-mediated phagocytosis
fca04724  Glutamatergic synapse
fca04912  GnRH signaling pathway
fca04928  Parathyroid hormone synthesis, secretion and action
fca05231  Choline metabolism in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    101092214 (PLD2)
   00565 Ether lipid metabolism
    101092214 (PLD2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04014 Ras signaling pathway
    101092214 (PLD2)
   04072 Phospholipase D signaling pathway
    101092214 (PLD2)
   04071 Sphingolipid signaling pathway
    101092214 (PLD2)
   04024 cAMP signaling pathway
    101092214 (PLD2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    101092214 (PLD2)
 09150 Organismal Systems
  09151 Immune system
   04666 Fc gamma R-mediated phagocytosis
    101092214 (PLD2)
  09152 Endocrine system
   04912 GnRH signaling pathway
    101092214 (PLD2)
   04928 Parathyroid hormone synthesis, secretion and action
    101092214 (PLD2)
  09156 Nervous system
   04724 Glutamatergic synapse
    101092214 (PLD2)
 09160 Human Diseases
  09161 Cancer: overview
   05231 Choline metabolism in cancer
    101092214 (PLD2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:fca04131]
    101092214 (PLD2)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.4  phospholipase D
     101092214 (PLD2)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101092214 (PLD2)
 Endosome - Golgi transport
  Others
   Others
    101092214 (PLD2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PX PLDc_2 PLDc PH PH_2
Motif
Other DBs
NCBI-GeneID: 101092214
NCBI-ProteinID: XP_023099516
Ensembl: ENSFCAG00000008040
Position
E1
AA seq 933 aa AA seqDB search
MAATPQSLFPAGGELDSSQLQMEPDELDTLREGEDPADRMHPFLAIYDLQPLKMHPLVFA
PGVPVTAQVVGTERYTSGSKVGTCTLYSVRLTHGAFTWTTKKKFRHFQELHRDLLRHKVL
MSLLPLARFATTHPPAGEAANREMPSLPRAGPEGSSRHASSKQKYLENYLNRLLTMSFYR
NYHAMTEFLEVSQLSFIPDLGSKGLEGVIRKRSGGHRVPGLTCCGRDQVCYRWSKRWLVV
KDSFLLYLCLETGVISFVQLFDPGFEVQVGKRSTETRYGVRIDTSHRSLILKCGSYRQAR
WWGQEITELAQGPGRDFIQLHRHDSYAPPRPGTLARWFVNGAGYFAAVADAIAGAQEEIF
ITDWWLSPEIYLKRPAHSDDWRLDIMLKKKAEEGVRVSVLLFKEVELALGINSGYSKRAL
MLLHPNIKVMRHPDQVTLWAHHEKLLVVDQVVAFLGGLDLAYGRWDDLQYRLTDLGDPSE
PAAPQPPTPGSDAPATPDLSQNQLFWLGKDYSNLITKDWVQLDRPFEDFIDRETTPRMPW
RDVGVAVHGLPARDLARHFIQRWNFTKTTKAKYKTPVYPYLLPKSTSTADQLSFTIPGGQ
CATVQVLRSVDRWSAGTMENSILNAYLHTIRESQRFLYIENQFFISCSDGRTVLNKVGDE
IVDRILKAHKQGQRFRVYVLLPLLPGFEGDITTGGGNSIQAILHFTYRTLCRGEYSILHR
LKAAMGTAWRDYISICGLRTHGELGGHPVSELIYIHSKMLIADDRTVIIGSANINDRSLL
GKRDSELAVLIEDTEMEPSLMDGGEYQAGRFALSLRKHCFSVILGAHARPDLDLRDPVCD
DFFQLWQDTAESNANIYEQIFRCLPSNATRSLRALREYVAVEPLATVSPPLARSELTQVQ
GHLVHFPLKFLEDESLLPPLGSKEGVMPLEVWT
NT seq 2802 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgaccccccagagcctcttccccgcggggggcgagctggactccagccagttg
cagatggagcccgacgagctggacactctgagggagggggaggacccagctgaccggatg
caccctttcctggccatctacgacctgcagcctctgaaaatgcaccccttggtgttcgcc
cctggggtgcccgtcacagcccaagtggtgggaaccgaaagatacaccagcggatccaag
gtgggaacctgcactctgtattccgtccgcttgactcacggcgcctttacctggacaacc
aagaagaagttccgtcatttccaggagctgcaccgggacctcctgaggcacaaagtcttg
atgagtctgctccctctggcccgctttgccaccacccatccccccgccggagaagccgcc
aaccgcgagatgccctctctgcctcgcgcaggacccgagggctcctccagacacgcgtcc
agcaaacagaaatacctggagaattacctcaaccgcctcctgaccatgtctttctaccgc
aactaccacgccatgacggagttcctggaagtcagccagctctccttcatcccagacctt
ggctccaaaggactggaaggagtgatccggaagcgttcgggcggccaccgagttcctggc
ctcacctgctgtggccgggaccaagtgtgttaccgctggtccaagaggtggctggtggtg
aaggactctttcctgctgtacctgtgcctcgagacgggcgtcatctcctttgttcagctc
tttgaccctggcttcgaggtgcaggtggggaaacggagcactgagacgcggtacggggtc
aggatcgacacctcccacaggtccctgatcctcaagtgtggcagctaccggcaggcacgg
tggtggggccaggagatcacggagctggcccagggcccgggaagagacttcatacagctg
caccgtcacgacagctatgccccgccccggcccgggaccttggcccggtggtttgtgaac
ggggcgggttactttgccgctgtggcagacgccatcgcaggagctcaagaggagattttc
atcaccgactggtggttgagtcctgagatttacctgaagcgtccggcccattcagatgac
tggagactggacattatgctcaagaagaaggcggaggagggtgtccgtgtgtccgtactg
ctgtttaaggaggtggagctggccttgggcattaacagcggctacagcaagagggctctg
atgctgctgcaccccaacataaaggtgatgcgtcacccggaccaggtgacgctgtgggcc
catcatgagaagctcctggtcgtggaccaagtagtggccttcttgggagggctggacctc
gcctacggccgctgggacgacctgcagtaccggctgactgacctcggggacccctctgaa
ccagccgccccacagcctcccacccccggctcagacgctccggccaccccagacctgtcc
caaaaccaactcttctggctgggcaaggactacagcaatcttatcactaaggactgggtg
cagctggaccggccttttgaggatttcatcgacagggagaccacgccccggatgccatgg
cgggacgtaggggtggccgtccacggtctgcccgcccgggacctggcccgccacttcatc
cagcgctggaatttcaccaagacgaccaaggccaagtacaagacccccgtgtacccttac
ctgctgcccaaatccaccagcaccgcggaccagctctccttcacgatcccgggggggcag
tgcgccactgtgcaggtcttgcggtcggtggaccgttggtcagcagggacgatggaaaac
tccatcctcaatgcctacctgcacaccatcagggagagccagcgcttcctgtacatcgag
aatcagttctttattagctgctcggacgggcggaccgttctgaacaaggtgggcgatgag
attgtggacagaatcctgaaggcccacaaacagggccagcgtttccgagtctacgtgctt
ctgcccctgctgccggggtttgaaggtgacatcacgacaggtggtggtaactccatccag
gccattctgcacttcacttacaggaccctgtgccgtggggaatattcgatcctacatcgc
ctcaaagcagccatggggacagcgtggcgggactacatatccatctgcgggcttcgcaca
cacggagagctgggcgggcacccggtctccgaactcatctacatccacagcaagatgctc
atcgcagatgaccggacggtcatcatcggctccgccaacatcaacgaccggagcttgctg
gggaagcgagacagtgagctggccgtgctgatcgaggacacagagatggaaccatccctc
atggacggtggggagtatcaggcgggccggtttgctttgagtctgcggaagcactgcttc
agtgtgattctcggggcacatgcccggccagacctggatctccgagaccctgtctgtgat
gacttctttcagctgtggcaggacacagccgagagcaatgccaatatctatgagcagatc
ttccgctgcctgccatccaatgccacacgctctctcagggcgctccgggagtacgtggcc
gtggagcccctggccacagtcagcccacctttggcccggtctgagctcacccaggtccag
ggccacctggtccactttcccctcaagttcctggaggatgagtctttgctgccccccctg
gggagcaaggaaggcgtgatgcccctcgaagtgtggacatag

DBGET integrated database retrieval system