KEGG   Felis catus (domestic cat): 101084076Help
Entry
101084076         CDS       T02385                                 

Gene name
PSENEN
Definition
(RefSeq) gamma-secretase subunit PEN-2 isoform X1
  KO
K06170  presenilin enhancer 2
Organism
fca  Felis catus (domestic cat)
Pathway
fca04330  Notch signaling pathway
fca05010  Alzheimer disease
Module
fca_M00682  Notch signaling
Brite
KEGG Orthology (KO) [BR:fca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04330 Notch signaling pathway
    101084076 (PSENEN)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084076 (PSENEN)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEN-2
Motif
Other DBs
NCBI-GeneID: 101084076
NCBI-ProteinID: XP_003997969
Ensembl: ENSFCAG00000030316
Position
E2
AA seq 147 aa AA seqDB search
MWQRLPSGGNRFHWGVVVRDPCICHLGSRLGSCPYRPSGRLRLSATMNLERVSNEEKLNL
CRKYYLGGFAFLPFLWLVNIFWFFREAFLVPAYTEQSQIKGYVWRSAVGFLFWVIVLTTW
ITIFQIYRPRWGALGDYLSFTIPLGTP
NT seq 444 nt NT seq  +upstreamnt  +downstreamnt
atgtggcaaaggcttccaagcggaggaaataggttccactggggcgtggttgttcgcgat
ccctgcatctgtcacctggggtcaaggctcggctcttgcccttacagaccctcgggacga
ctccgcctcagcgcaactatgaacttggagcgggtgtccaacgaggagaagctaaatctg
tgccggaagtactacctgggtgggtttgctttcctgccttttctctggttggtcaatatc
ttctggttcttccgagaggcgttcctagtcccggcgtacacagagcagagccaaatcaaa
ggctatgtctggcgctcagctgtgggcttcctcttctgggtgattgtactcacaacctgg
atcaccatcttccagatctaccggccccgttggggcgcccttggtgactatctctccttc
accatacccctaggtaccccctga

DBGET integrated database retrieval system