KEGG   Felis catus (domestic cat): 101084148Help
Entry
101084148         CDS       T02385                                 

Gene name
ERN1
Definition
(RefSeq) serine/threonine-protein kinase/endoribonuclease IRE1 isoform X1
  KO
K08852  serine/threonine-protein kinase/endoribonuclease IRE1 [EC:2.7.11.1 3.1.26.-]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04140  Autophagy - animal
fca04141  Protein processing in endoplasmic reticulum
fca04210  Apoptosis
fca04932  Non-alcoholic fatty liver disease (NAFLD)
fca05010  Alzheimer disease
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101084148 (ERN1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101084148 (ERN1)
  09143 Cell growth and death
   04210 Apoptosis
    101084148 (ERN1)
 09160 Human Diseases
  09164 Neurodegenerative disease
   05010 Alzheimer disease
    101084148 (ERN1)
  09167 Endocrine and metabolic disease
   04932 Non-alcoholic fatty liver disease (NAFLD)
    101084148 (ERN1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fca01001]
    101084148 (ERN1)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     101084148 (ERN1)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.-  
     101084148 (ERN1)
Protein kinases [BR:fca01001]
 Serine/threonine kinases: Other
  IRE family
   101084148 (ERN1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Ribonuc_2-5A Pkinase_Tyr PQQ_2 PQQ Pkinase_fungal APH Kdo
Motif
Other DBs
NCBI-GeneID: 101084148
NCBI-ProteinID: XP_003997136
Ensembl: ENSFCAG00000003507
Position
E1
AA seq 973 aa AA seqDB search
MCLGCGLSNLSVFICEIFGSPSTVTLPETLLFVSTLDGSLHAVSKRTGSIKWTLKEDPVL
QVPTHVEEPAFLPDPNDGSLYTLGGKNNEGLTKLPFTIPELVQASPCRSSDGILYMGKKQ
DIWYVIDLLTGEKQQTLSSAFADSLCPSTSLLYLGRTEYTITMYDTKTRELRWNATYFDY
AASLPEDDGDYKMSHFVSNGDGLVVTVDSESGDVLWIQNYASPVVAFYVWQREGLRKVMH
INVAVETLRYLTFMSGEVGRITKWKYPFPKETEAKSKLTPTLYVGKYSTSLYASPSMVHE
GVAVVPRGSTLPLLEGPQTDGVTIGDKGECVITPSTDLKFDPGLKGKSKLNYLRNYWLLI
GHHETPLSASTKMLERFPNNLPKHRENVIPADSEKKSFEEVINLVEQTSENAPTAVSQEV
EEKFEHAPAKPEAPVDSVLKDIATIILSTFLLIGWVAFIITYPLSMHQQQQLQHQQFQKE
LEKIQLLQQQQLPFHPPGDVAQDAELLDSSGLYSESSGTSSPSTSPRASNHSLHSSGSAS
RAGASPFLDQDDEDEETSMVIVGKISFCPKDVLGHGAEGTIVYRGMFDNRDVAVKRILPE
CFSFADREVQLLRESDEHPNVIRYFCTERDRQFQYIAIELCAATLQEYVEQKDFAHLGLE
PITLLQQTTSGLAHLHSLNIVHRDLKPHNILLSMPNAHGRIKAMISDFGLCKKLAVGRHS
FSRRSGVPGTEGWIAPEMLSEDCKDNPTYTVDIFSAGCVFYYVISEGSHPFGKSLQRQAN
ILLGAYSLDCLHPEKHEDVIARELIEKMIAMDPQKRPSAKHVLKHPFFWSLEKQLQFFQD
VSDRIEKESLDGPIVKQLERGGRAVVKTDWRENITVPLQTDLRKFRTYKGGSVRDLLRAM
RNKKHHYRELPAEVRETLGSLPDDFVRYFTSRFPHLLPHTYRAMEPCSHERLFQPYYFHE
PPELRPPVTPDAL
NT seq 2922 nt NT seq  +upstreamnt  +downstreamnt
atgtgccttggatgcgggctctctaacctcagcgtcttcatctgtgagatttttggaagt
cccagcacagtgacacttcccgaaaccttgttgtttgtgtcaaccctggatggaagcttg
catgctgtcagtaagaggacgggctcaatcaaatggactttaaaagaagatccggttctg
caggttccaacgcatgtggaagagcctgccttcctcccagatcccaatgatggcagcctg
tatacacttgggggcaagaataatgaaggcctgacgaaacttccctttaccatcccagag
ctcgtacaggcatccccatgccgaagttcagatggaattctctacatgggtaaaaagcag
gacatttggtatgttattgatcttctgaccggggagaagcagcagactttgtcatcggcc
tttgcagacagtctctgcccatcaacctctctgctgtatctcgggcgaacagagtacaca
atcaccatgtacgacaccaaaacccgcgagctccggtggaatgccacctacttcgactac
gcggcctcactgccggaggacgacggggactacaagatgtcccactttgtgtccaacggc
gatgggctggtggtgaccgtggacagtgaatctggcgacgtcctgtggatccaaaactac
gcttcccctgtggtggccttttatgtctggcagcgggagggtctgaggaaggtgatgcac
atcaacgtcgcagtggagacgctgcgctatctgaccttcatgtctggggaggtgggccgc
atcaccaagtggaagtacccgttccccaaggagacggaggccaagagcaagctgacgccc
accctgtatgtcgggaaatactctaccagcctgtatgcctccccctccatggtgcacgag
ggggtcgccgttgtgccccggggcagcacacttcctttgctggaaggcccccagactgac
ggggtcaccattggggacaaaggggagtgtgtgatcacgcccagcacagacctaaagttt
gaccctgggctcaaagggaagagcaagctcaactacttgaggaactactggcttctgata
ggacaccatgaaacccccctgtctgcgtctaccaagatgctggagaggttccccaataat
ctgcccaaacatcgagaaaatgtgattcctgccgattcagagaagaagagctttgaggaa
gttatcaacctggtcgagcagacttcagaaaacgcgcccaccgccgtttcacaggaagtg
gaggagaagttcgagcatgcccccgctaagcccgaggcccccgtggactctgtgctgaag
gacatagccaccatcatcctgagcaccttcctgctcatcggctgggtggccttcatcatc
acctaccccttgagcatgcatcagcagcagcagctccagcaccagcagttccagaaggaa
ctagagaaaatccagctcctgcaacagcagcagctgcccttccatccccctggagacgtg
gctcaggatgcggagctcctggactcgtccggcctgtactcagagagctcgggcaccagc
agccccagcacatcccccagagcctccaaccactcgctccactccagtggctctgcctcc
agggctggtgccagccccttcctggatcaggacgatgaagatgaggaaaccagcatggtg
attgtcgggaagatctcattctgtcccaaggacgtgctgggccacggagctgagggcacg
attgtgtaccggggcatgttcgacaaccgcgacgtggccgtcaagaggatcctccccgag
tgtttcagtttcgcggaccgtgaggtccagctgcttcgggaatcagacgagcaccccaac
gtgattcgttacttctgcacggagagggaccggcagttccagtacattgccatcgagctg
tgtgcggccaccctgcaggagtacgtggagcagaaggactttgcccacctcggcctggag
cccatcaccttgctgcagcagaccacctcgggcctggcccatttgcactccctcaacatt
gttcacagagacctgaagccccacaacattctcctgtccatgcccaacgcacatggcagg
atcaaggccatgatctctgactttggcctctgcaagaagctggctgtgggcaggcacagt
ttcagccgccgctcaggagtgcctggcacagaaggctggattgctccagagatgctgagc
gaggactgtaaggacaatcccacctacacagtggacatcttctctgcgggctgtgtcttt
tactacgtgatatctgagggcagccacccttttggcaagtccctgcagcggcaggccaac
atcctcctgggcgcctacagcctcgactgcttacacccggagaagcacgaagacgtcatt
gcccgggaattaatagagaagatgatcgcaatggatcctcagaaacgcccctctgcaaag
catgtgctgaagcacccgttcttctggagcctggaaaagcagctccagttcttccaggac
gtgagtgaccgaatagaaaaggaatccctggacggcccgatagtgaagcagctggagcga
ggcgggagagccgtggtgaagacggactggagagagaacatcaccgtccccctgcagaca
gatctgcgtaaattcagaacctataaaggtggctctgtccgcgaccttctccgagccatg
agaaacaagaagcaccactaccgggagctccccgcggaggtgcgggagacgctgggctct
ctccccgacgactttgtgcgctacttcacgtcccgcttcccccacctcctcccccacacc
taccgggccatggagccctgcagccacgagaggctcttccagccttactacttccacgag
cccccagagctccggccccccgtgactccagacgccctttga

DBGET integrated database retrieval system